Home Favorites My Account Menu
login
Advertisement

Search for a Worksheet

filter by
Grade
 
Spelling Favorite Created By Created on Words Employment words
Aimee Allen
Thursday
Feb 22, 2024
applicationcompanydisability educationemployeeemployerexperiencehealthheightinformationoccupationreferencessignaturesupervisorweight
Load

Thursday
Feb 22, 2024
brightflightknifelightninglimbmidnightsighthumbwrongwrote
Load

Thursday
Feb 22, 2024
Fossilcartilagechaseconveyor beltcruisingferociousgillspollutionpredatorprey
Load

Thursday
Feb 22, 2024
actionapplebeginberrybreakdidn tdifferentdisagreeearlyeighthappilyhereimportantkindestkneepictureroadstrangetheythought
Load

Thursday
Feb 22, 2024
FebruaryTuesdayballcan t carelesslycreatureforgettinggoldgreatheartmeetplaneplaygroundridersadlytheretravelwalkedwasteyoung
Load

Wednesday
Feb 21, 2024
brushcheckingescapeeventforeverhumanhydroelectricimportantjunklonelyneverperpendicularreunionsearchshapesteal
Load
WEEK 24 LANDRY
Suffix -y, -ty, -ity
S. Chung
Wednesday
Feb 21, 2024
activeactivitycruelcrueltycuriositycuriousdensedensitydifficultdifficultyequalequalityhonesthonestyloyalloyaltysinceresincerityspecialspecialty
Load

Wednesday
Feb 21, 2024
Washingtonavocadodependentexplorehomemadeimitationluxuriousmaterialmellowmicrowavemortifiedmullmurkynimblenonstopnoteworthypleasantprobablyprosecutedprovisionsquarterbackrecede
Load
WEEK 24 RHILAN
WEEK 24
Wednesday
Feb 21, 2024
accessoryallowedapparatusarchitecturecapitalismcorporationdistressforwardincapacitatejudiciallicensemachineobliqueporcelainregionrenaissancerendezvousridiculoussilhouettesubscribesupersonictranscript
Load
WEEK 24 JORDYNN
Spelling Week 9- 5thGrade
Wednesday
Feb 21, 2024
JuneMassachusettsagreementancestorauthenticitycompactcriticizeeagleelasticityescapeethnicityhorizonnovelpersecutionpilgrimpublicityrecentsinglevoyagewalrus
Load
cocosheets.com/1038453-nr73
Spelling Unit 2 Week 10- 3rd Grade
Wednesday
Feb 21, 2024
I’vearen’tcan’tcontaincouldn’tdidn’tdoesn’tfrontlet’so’clockshould’vewon’twouldn’twould’veyou’ve
Load

Wednesday
Feb 21, 2024
afraidamygdalaappealcuriousdocumentaryfactorfascinationidentifymoodresponsetensionunrealism
Load
asdfasdfsdfsdfasdf
WEEK 24
Wednesday
Feb 21, 2024
agriculturealuminumbaccalaureatebipartisanbravadocongenialhabitatinsurancejudicialmarriagerascalrespiteridiculousscrutinizesouvenirstrategiststrenuoussympathyuglinessvideotape
Load
9/WEEK 24 KINDEN LEXZI
Spelling 9.1
Wednesday
Feb 21, 2024
carefulcarriedcitiescloselycontainerdelightfulfarmerfighterfriendlyhurriedjoyfulloudlypowerfulquicklysingerspeakersteadilystoriesteachertrulywatchfulwonderful
Load
Days and Months
Beth Price-Almeida
Wednesday
Feb 21, 2024
AlabamaAprilAugustDecemberFebruaryFridayGabrielJanuaryJulyJuneMarch MayMondayNovemberOctoberSaturdaySeptemberSundayThursdayTuesdayVerbenaWednesday
Load

Wednesday
Feb 21, 2024
EatRiverRockSpellingTherefore WeakWeekWhateverWhenWin
Load

Robin Proctor
Wednesday
Feb 21, 2024
badgebiggerbiggestbudgefasterfastestfudgeledgepledgesaddersaddestshortershortestslowerslowest
Load
Greek and Latin Roots- Dict/Logue
Wednesday
Feb 21, 2024
contradictdialoguedictatedictatordictionepilogueindicatemonologuepredictprologue
Load
sped spelling test 634928-1038363-jzqs
josie
Wednesday
Feb 21, 2024
alabama beefy white gravyalaskan hibiscus grilled salmon gravyarizona palo-verde sauce green gravyarkansas pink-appleblossom pink-rose gravycalifornia cayenne golden poppy-flower ocean-salt gravycolorado blue-spruce beef gravyconnecticut white-oak leaf mountain-laurel pink-rose gravydelaware peach-blossom blue-hen first state seafood gravyflorida sunshine orange-zest palm sauce orange-blossom mexican-seafood rose gravygeorgia peaches cherokee-rose atlantic ocean seafood peach-pinkrose gravyhawaiian flower-hibiscus aloha-aloe yellow hibiscus grilled eggyolk pacfic seafood gravyidaho gem potato gravyillinois lincoln native violet gravyindiana tulip-peony gravyiowa hawkeye wild-oak-rose gravykansas sunflower-cottonwood gravy
Load
sped 5th grade spelling test. cocosheets.com/1038363-jzqs

Wednesday
Feb 21, 2024
AuthorBookstoreCafeteriaCharacterChildrenExploreLearnLibraryMuseumScene
Load
Week of Feb. 26 - Mar. 1, 2024
1st Phonics Words with st
Wednesday
Feb 21, 2024
bestfastjustlostmustotherstepstoptheiryour
Load
1st Phonics st Words

Jennifer Pharris
Wednesday
Feb 21, 2024
awfulcallerchalkdrawfalsefaultsawsmalltalkingwalk
Load
U4 W5 (1A)
Jennifer Pharris
Wednesday
Feb 21, 2024
awfulcallerchalkdrawfalsefaultsawsmalltalkingwalk
Load
U4 W5 (B)
Jennifer Pharris
Wednesday
Feb 21, 2024
alterationapplaudedaudiencesbecausecaughtclausedaughterdinosaurfoughthaltedmaltshawlsoughtsprawlingsquallstalkstrawberrythoughtfulvaultwallpaper
Load
Vowel Combinations
Wednesday
Feb 21, 2024
Augustannoyauthorautographautomobilecancelchalkcrawlfalsefoundationlabellawnloyalouroutsidesaltshawlshoutsquirrelwalk
Load
U4 W5 (A)
Jennifer Pharris
Wednesday
Feb 21, 2024
alteraweawfulcallerchalkcoughdrawfalsefaulthaltlawsrawsawsmallstrawtalkingtalltaughtthawwalk
Load

myra
Wednesday
Feb 21, 2024
alacrityamputationannoyanceatollbarettecalaminecallouschimpanzeecomposureconspiracycordialdespondencydexterityexasperationflabbergastedgrandiosemarmalademiracleorchidsparalysisperoxidequantumreprobatesinewysophomore
Load
U4 W5 (O)
Jennifer Pharris
Wednesday
Feb 21, 2024
alterawecallercaughtchalkcoughdrawnfalsefoughthaltlawsshawlsmallsquallstalkstrawstrawberrytalkingthoughtwalker
Load
sped 5th grade health 634918-1038310-r29t
josie
Wednesday
Feb 21, 2024
galactose and lactose free dietgalactose and lactose restricted dietgalactose and lactose restrictiongalactose free dietgalactose restricted dietgalactose restrictionhigh galactose and lactose diethigh galactose diethigh lactose dietlactose free dietlactose restricted dietlactose restrictionlow galactose and lactose dietlow galactose dietlow lactose diet
Load
sped 5th grade health. cocosheets.com/1038310-r29t
Helpful Hundred March
Wednesday
Feb 21, 2024
acrossbusinesscousinfortyinterestinginvisiblemanymorningoncesomething thanthen
Load
oo spelling words
Melissa Webb
Wednesday
Feb 21, 2024
boothbroodcartoondroopigloomushroomnoodlepoodlespoolswoop
Load
February 21st to February 28th 2024
Wednesday
Feb 21, 2024
badgebiggerbiggestbudgefasterfastestfudgeledgepledgesaddersaddestshortershortestslowerslowest
Load
February 22nd to February 28, 2024

6.2.3.
Wednesday
Feb 21, 2024
ballotbannerbarrendwellingfabricfactorformalfunnelkingdommentalmufflernecklacepantryponderprosperpumpkinraggedsnapshotvictimwallet
Load
First 25 Words
Wednesday
Feb 21, 2024
Abednegoa fortioriab initio ab intraabasiaabjuredablutionaryabscissonabsquatulateacarologyaccessionacclivityaccumulativeacetateacidifyacquittalacrodontad valoremadipocereadmonishadroitadulatoradvisoryadvocacy journalismaerate
Load
UIL SPELLLING
TEST
Wednesday
Feb 21, 2024
chasedadmanmemomsmilewewereyou
Load
Spelling and Vocabulary (PB) - List 1
Wednesday
Feb 21, 2024
againbecausebeforebrowncoulddoesflyfunnyknowlittle
Load
G$, U4, W2 - Inflectional Endings y to i
Wednesday
Feb 21, 2024
appliedcarriescozilydizziesteasilyemptierfactoriesfamiliesfunnierhandilyhappiestjumpierlaziermarriesmerrierpenniesprettilyrepliedscaringsilliestskippedsorriesttastingvariedworried
Load
Wonders, G4, U4, W2 Inflectional Endings y to i
Shiloh. Chapters 5-8
Wednesday
Feb 21, 2024
commencesdevilmentenvyfrankfurterslean-toloyalnuzzlingremedytendedtuckered
Load
Shiloh. Chapters 5-8
Open Syllables
Wednesday
Feb 21, 2024
besidebeyondbisoncidercloverdefenddelaydemanddiverfamouspreventradarrazorsecretsilencespokenstolentulipvacancyveto
Load
Weej 2-20
AM
Wednesday
Feb 21, 2024
announcerapplaudaudience autumnboundarycautioncountdownexhaustedfaucethauledlaunchmispronouncenaughtysausagesurround
Load
2/21/24
Wednesday
Feb 21, 2024
AccomplishAnnoyAtmosphereAwaitedBudgetCharacterDesignDifferentDigestFascinateGymnasiumJewelKindnessKnowledgeListenQuicklyRecentlyRefrigerateSubjectThoughtYesterday
Load
Spelling and Vocabulary (G&B) - List 75-77
Wendy Gale
Wednesday
Feb 21, 2024
broccolichewiestcrueldeliciousdistanceembarrasshappilyislandjuiciestreplied
Load

Wednesday
Feb 21, 2024
frogmothquotespoontooktoothwhywood
Load

Kelly P
Wednesday
Feb 21, 2024
athleteathleticdecide decisiondivisionhumanehumanitymicroscopemicroscopicnaturalnatureproduceproductionreviserevision
Load

Kelly P
Wednesday
Feb 21, 2024
athleteathleticdecide decisiondivisionhumanehumanitymicroscopemicroscopicnaturalnatureproduceproductionreviserevision
Load
CMAS Prep 3 !
Athena Bateman
Wednesday
Feb 21, 2024
accidentareaartisticcelebratecompanycreatingcrocodiledangerousdepartmentdinosaurelephantexercisefaithfullyhowevermagazinemiraclemunchingpanickingparagraphprobablyreactionregulatesanitizesyllabletomorrow
Load
Spelling 1.0
Miss katherine Wolfe
Wednesday
Feb 21, 2024
allowedalwaysantihistaminebothcommercialcounterclockwisedepressantexerciseincomingindicateintendingintersectioninterstatemaintainmaneuveroctagononcomingprohibitedstimulantyield
Load
Spelling list 18
Katie Land
Wednesday
Feb 21, 2024
bandanaburritocaravancargogallantguitarhammockiguanalassomattresspajamaspatioplazaponchosalsasiestatomatotsunamitycoonvanilla
Load

Miss katherine Wolfe
Wednesday
Feb 21, 2024
allowedalwaysantihistaminebothcommercialcounterclockwisedepressantexerciseincomingindicateintendingintersectioninterstatemaintainmaneuveroctagononcomingprohibitedstimulantyield
Load
Week 23 Group A
Julie Parks
Wednesday
Feb 21, 2024
boastcellochoircoastalcomposeduetelectricityenergyengineergeneratesolotechnology
Load
Spelling words
Miss katherine Wolfe
Wednesday
Feb 21, 2024
allowedalwaysantihistaminebothcommercialcounterclockwisedepressantexerciseincomingindicateintendingintersectioninterstatemaintainmaneuveroctagononcomingprohibitedstimulantyield
Load
Week 23 Group B
Julie Parks
Wednesday
Feb 21, 2024
boastcellochoircoastalcomposeduetelectricityenergyengineergeneratesolotechnology
Load
Week 23 Group A
Julie Parks
Wednesday
Feb 21, 2024
betterbringcleandifferentdrawfullpointshowsmarttowardwashwater
Load

Wednesday
Feb 21, 2024
CanInandawaybigcomedownforfunnygoinlookmynotrunsaidto tootwoupwhereyou
Load
week 20 homophones
Dawn Tackett
Wednesday
Feb 21, 2024
attrbutesbeingboardboredclearflourflowerhairhareit'sleave nounorbitpositionquadrilateralspherestairs staressugar
Load
List #21
Trisha Buhre
Wednesday
Feb 21, 2024
New Jersey New Mexicoadmireambitionchaoticcollectioncommittedforgottenfoundationmuseumpracticalpriorproceedquizzedrecreationrevisedshippingsobbingtraditionvisible
Load
List #20
Trisha Buhre
Wednesday
Feb 21, 2024
NevadaNew Hampshireaffectionagreeableancientantiqueapologybelieveddistressgenerousimaginationinjuredmarginobservingoriginalpersuasionpleasurableseizesurrendersurviving
Load
sped health 634889-1038103-2r5n
lainiee
Wednesday
Feb 21, 2024
alabama camellia drinking wateralabama drinking wateralabama gulf of mexico drinking wateralabama river drinking wateralabama southern pine drinking watersouthern pine drinking water
Load
sped 5th and 6th grade alabama history- water health. sped 5th and 6th grade health. cocosheets.com/1038103-2r5n
sped writting 634888-1038093-kd69
lainiee
Wednesday
Feb 21, 2024
alabama mexican gulf pine seafoodalaskan frontier sitka spruce pacific ocean russian grilled steak seafood salmonarizona canyon state four corners mexican cheese palo-verde shrimp basketarkansas natural pine-pink apple blossom red river seafoodcalifornia golden eagle sauce pacific ocean salmon grill n' sautéed redwood poppy valley seafoodcolorado centennial-pineapple blueberry sauce four corners blue spruce spinach-turmeric coconut- coleslaw n' collard green's seafood mash potato saladconnecticut constitutional-white oak atlantic ocean mountain laurel hartford seadishdelaware first state dover style american holly-peach blossom atlantic coast blue hen seasalt delaware bay-atlantic ocean pink rose seafoodflorida sunshine orange sabal palm tallahassee beach orange blossom key west shore gulf of mexico-atlantic ocean pearl blue sea pear-lemonlime watermelon toast seafoodgeorgia peachy atlanta style live oak-cherokee rose gulf of mexico-atlantic ocean savanna river beach n' vidalia onion's sauerkraut peanut butter sauce augusta style oyster sauce lobster seafoodhawaiian aloha red flower sauce kujui oyster mushroom sauce kukui yellow hibiscus fried pacific ocean salmon grillidaho potato-gem state western white pine-syringa mock orange boise-rocy mountain style salmon river yellowstone national forest park british columbia-alberta canadian style maple syrup soaked seafoodillinois lake michigan style white oak native violet lavender oil springfield-chicago mississippi river-illinois river red lobster seafoodindiana tulip-peonies indianapolis sauce lake michigan creek style salsa ohio river white rice racecar seafood dishiowa oak wild rose hawkey desmoines missouri river shrimp sauce desmoines river fish oil sauce-mississippi river sauce crabdishkansas sunflower cottonwood-native sundflower style wichita-topeka sauce arkansas river kansas city-missouri river seafood
Load
sped 4th and 5th grade writting. cocosheets.com/1038093-kd69
R Blends #1
Isaiah Austin
Wednesday
Feb 21, 2024
Fredbragbranbrimcrabcramcredcribdragdripdropdrumfretfrimfrog
Load
6th Grade: Wordly Wise Lesson 12
Jill White
Wednesday
Feb 21, 2024
abandonadversarybaffleblundercolossaldetecthauloverpowerrejoicescoffsentinelsiegesinistervictorvictoriouswoewoeful
Load
6th Grade: Wordly Wise Lesson 12
5th Grade Episodes 4-6
Wednesday
Feb 21, 2024
actualassortedcombinedeliciousenormousfuriouspositivelyshimmer
Load
6th Grade: Wordly Wise Lesson 11
Jill White
Wednesday
Feb 21, 2024
abbreviateabbreviationappropriateexcludefancifulfutilegrudgegrudginginspirationinspiremajorityperseveranceperseverepossesspossessionprejudiceresolutesneerunanimityunanimousunruly
Load
Wordly Wise Lesson 11
er, est, dge
Wednesday
Feb 21, 2024
badgebiggerbiggestbudgefasterfastestfudgeledgepledgesaddersaddestshortershortestslowerslowest
Load
Unit 6 Week 2-Vowel Teams
Stacey K Kibilko
Wednesday
Feb 21, 2024
bookcookfootgoodlookpushputshookstoodwood
Load
Spelling Test - List 19 (Makeup)
Trelisa Christian
Wednesday
Feb 21, 2024
anglebarrelbushelcaptainchuckledungeonfablefrightenglobalgovernorheronlenghtenlistenmarvelmountainnozzlepillarpracticalpretzelsalmonsandalscissorssignalsloganwoolen
Load

Grace
Wednesday
Feb 21, 2024
comfortableeligibleexcitablefavorablehorribleplausiblereversiblesensibletolerablevaluable
Load
Unit4 week 2
List 22
6th Grade Bible
Wednesday
Feb 21, 2024
accidentally comparatively entangleevacueeextinguish extraneousfragileirrevocablemarriagemileageperceive persevereprejudice university vertebra
Load
Unit 3 Week 5
Ashley Price
Wednesday
Feb 21, 2024
interceptintercominteriminterruptintertwineoverjoyedoverloadoverratedoverreactoverweightsubheadingsubmarinesubmergesubwaysubzeroundercookedunderfedunderfootunderpassunderstudy
Load

Wednesday
Feb 21, 2024
camecatchcaughtcomefindfoundgavegivemademakesaidsaysleepslepttaketelltoldtookwearwore
Load
Spelling Sort 59
ROOTS Lesson 15
Joanne Wilbers
Wednesday
Feb 21, 2024
locallocationlocomotionrelocatetechnicalitytechniciantechniquetechnology
Load

Wednesday
Feb 21, 2024
askedbumpeddressedjumpedloadedmailedmeltedmissedneededpassedpickedprayedrainedsnowedstartedturnedtwistedwaitedwalkedyelled
Load
Spelling sort 58

Wednesday
Feb 21, 2024
badgesboxesbushesclassesdishesdresseseyesgirlsglasseshousesincheslunchesmonthspagespiecesplacesplantsstitchestaxeswishes
Load
Spelling Sort 57

Wednesday
Feb 21, 2024
aren'tcould'vecouldn'tdoesn'thasn'there'smight'veshe'llshould'veshouldn'tthere'sthey'llweren'twhat'swhere'swho'llwho'swould'vewouldn'tyou'll
Load
Spelling Sort 56
4 grade List 23
Monica Herrera
Wednesday
Feb 21, 2024
North CarolinaOhioTrinityachieveadviceaisleartificial atheistcastlecheerfulness clothing compromisedata delightfulevaluate flexiblefurniture honest intelligenceinterfere khakimusclepersuadeperturbpolicepreceptionscissorssoldierukulele virtue
Load
4 grade List 23
Monica Herrera
Wednesday
Feb 21, 2024
North CarolinaOhioTrinityachieveadviceaisleartificial atheistcastlecheerfulness clothing compromisedata delightfulevaluate flexiblefurniture honest intelligenceinterfere khakimusclepersuadeperturbpolicepreceptionscissorssoldierukulele virtue
Load

Wednesday
Feb 21, 2024
aboutaboveacrossafraidagainagoaheadalivearoundawaybecausebecomebeforebeginbehindbelievebelongbelowbesidebetween
Load
Spelling Sort 55

Wednesday
Feb 21, 2024
atebrakebreakeighthairharemailmalemeatmeetpairpearsailsaleslaysleighstealsteelsweatsweet
Load
Spelling sort 54

Wednesday
Feb 21, 2024
boardboredchordcoarsecordcourseforforthfourfourthhoarsehorseoarorepoorporesoarsorewarnworn
Load
Spelling sort 53
Module 6 Week 2 Play Louis Play - Vocabualry
Jacque Korth
Wednesday
Feb 21, 2024
authenticbarscontagiousdiscriminatoryduetsexposurefeversolosstereotypicalwillful
Load
Unit 5 Week 5
Wednesday
Feb 21, 2024
anchoranklebarberbucklecheddarcradlecuddledoublefiddlefrecklegamblehumblehustlejunglemarbleneedlepebbleramblesinglestaplestifletackletangletroubleuncle
Load
Week 25 Words
CCID
Wednesday
Feb 21, 2024
ankleappearsarrangebracebraceletbreathbreathecalmcircusconsentedcontinuecontinuedimprisonperhapsstatestatementtheirtheywritwritten
Load

Wednesday
Feb 21, 2024
attendancecompletionconcentrationconventiondevelopmentdisagreementexistenceimprovementinformationintermissioninventionirrigateperfectlypreparationrefreshmentrespectfulreversibleunbelievableuneventfulunhappiness
Load
Unit 27

Meagan Welch
Wednesday
Feb 21, 2024
Januaryauthorcalanderdeskdrilleleven expirenovelofferoriginalpicturerubyscripttimelineturn
Load

Meagan Welch
Wednesday
Feb 21, 2024
accessoryacquiesceasthmaaversebarracudaexpendituregenerousincandescentobjectivepermittedpreliminaryprounouncerapportsemicirclesimultaneously
Load

Mattiemay Brown
Wednesday
Feb 21, 2024
alabamaarkansasdelawarefloridakentuckylouisianamarylandmississippinorth carolinaoklahomasouth carolinatennesseetexasvirginawashington dcwest virginia
Load
2.2 spelling test
Cydnei Bogard
Wednesday
Feb 21, 2024
apprentinceaveragecabbagecooperativecouragecreativedetectiveheritageimagejusticeknowledgemeasurenativeolivepassageprejudicerelativeservicestoragevoyage
Load

Wednesday
Feb 21, 2024
anotherdoesevenhandlandlarge mentryturn uswhy
Load
sped ela 634855-1037889-cg6x
ashlynn
Wednesday
Feb 21, 2024
antisocialanxietydanny fenton classic galactosemiadanny fenton classic phenylketonuriadanny fenton galactosemiadanny fenton hypoglycemiadanny fenton phenylketonuriadanny fenton-phantomdanny phantomdanny phantom a glitch in timedanny phantom clonedanny phantom final episode- phantom planetdanny phantom heroes and villainsdanny phantom the next generationdanny phantom- sam. and danny's futer adventure's goin' ghostdepressionemo ultra-recylo vegeterianemogoth ultra-recylo vegeterianemogothic ultra-recylo vegeteriangothic ultra-recylo vegeterianhigh protein dietlearning disabilitieslow protein dietmeat eaterptsdsam manson vegansam manson vegeteriansamantha manson classic galactosemiasamantha manson galactosemiascoliosisself proclaimed emogothic ultra-recylo vegeterianself proclaimed ultra-recylo vegeterian emogoth ghost hunting sidekickshytv seriestv showultra-recylo vegeterianultra-recylo vegeterian self proclaimed gothvegeterian
Load
sped 5th grade ela. cocosheets.com/1037889-cg6x
c-21
Wednesday
Feb 21, 2024
authorcaterpillarcleverdollarhaven'thorrorhumorinventormayornectarrefrigerator sailorsingerswimmer teacherthey'revinegarvisitorworkerwould've
Load

Hannah Brown
Wednesday
Feb 21, 2024
bulgecollapsecollidecombinecompetecompletecontaincontrastcontrolconvincecould'veinsultpulseresultshould've
Load
week 21
3rd grade List 23
Monica Herrera
Wednesday
Feb 21, 2024
Calvarycafeteriacalculatorcalendarcapitalcelebratecelerycoconutconfidencecontinuallycottoncupboarddecisiondistanceglanceicicleinfluencejusticenoticeparticipatepracticepresenceprincerecessscenery
Load
Lesson 16
Cynthia Johnston
Wednesday
Feb 21, 2024
answeredbeginningbotheringcancelledcarpetingchattingcompellingdepositedgatheringknittinglisteningoccurredorderedquizzedscannedscrubbedshruggedskimmedstunnedsufferingthreateningtotaledupsettingwanderedwhipped
Load

Wednesday
Feb 21, 2024
HabakkukHaggaiZephaniahartilleryastronautbarrackscolonelconquerorcorpshelicopterinspectionlieutenantmissilenavigationopponentpersonnelpromotionradarsatellitesergeantsoldierspecialistsubmarineuniformvolunteer
Load
Week of 3/4 - 3/8
Jillian Morrissey
Wednesday
Feb 21, 2024
bleachersemployeeeuphoriaincreasejourneymildewneighborpedigreeproteinreceivesqueamishsweatertreatmentweatherweightless
Load
Week of 3/4 - 3/8
1-21 PCI
Wednesday
Feb 21, 2024
asbigbycitydofarmhomeinislakelike livemynotoceanonseesmallthethistownwhereyou
Load
James Forten Lesson 14
Cynthia Johnston
Wednesday
Feb 21, 2024
actualannualappreciateareaaudiocasualcreatecrueldiagnosedialdietgenuineinfluencemediamuseumpatriotpioneerpriorrealizeriotruinsocietytheatertrialvisualize
Load
Spelling Quiz Week 23
Wednesday
Feb 21, 2024
achieveagreeapronauthorbracketbucketbushelchickenclothingdeclaredegreegathermachineposterratherrocketsecretticketwhetherwhiskers
Load
Spelling Quiz Week 23 SPED **
Week 23 Spelling Quiz
Wednesday
Feb 21, 2024
agreeauthorbucketbusheldeclareposterrocketsecretticketwhether
Load
Spelling Quiz Week 23*
Week 26
Wednesday
Feb 21, 2024
captioncentercoolercrunchgrudgehopefulnationrotatesketchstation
Load
Advertisement