Home Favorites My Account Menu
login
Playwire Advertisement

Search for a Worksheet

filter by
Grade
 
Thursday Jul 9, 2026
4th Grade
K4 UNIT 1
AprilMarchOctoberSeptemberdayearthhappenlightnightoutsideroundseasonspinyear
READING FUTURE KID 4
Lisa Larson
Thursday Jul 9, 2026
3rd Grade
magnetic literacy Unit 1 Moduel 1
chargefirstforestobserverunningsquirrelsurprisedturnedwishesworking
Bobjane Ashby
Thursday Jul 9, 2026
5th Grade
AbbreviationConsequenceFossilGovernor.ImaginaryMarvelous.PeculiarScholarshipUsually.Village.
Thursday Jul 9, 2026
5th Grade
admirationangrilyappreciateawkwardbeginningconveniencecourageouscourteousdangerousdevelopforgottenhumourousjealousmedalmeddlemiddlemountainouspiecepoisonouspreparationsensationsensespontaneoustremendousvigorous
Jennifer Jenkins
Thursday Jul 9, 2026
8th Grade
DR Spell Check #7
adolescence aggressive attainable benefiting conference correlate credible illegitimate innumerable irrational irrelevance obedience repellant salvageable undesirable
DR Spell Check #7
Jennifer Jenkins
Thursday Jul 9, 2026
8th Grade
DR Spell Check #6
adrenalineallocate appendage aversion dissectempathy expurgate intervene introspection laryngitis memorandumprecede provocation secession sustenance
DR Spell Check #6
Jennifer Jenkins
Thursday Jul 9, 2026
8th Grade
DR Spell Check #5
adjudicate allegiance aristocracy benevolent bureaucracy equanimity generic genre hierarchy malicious modality omniscient pedagogy progenitor recapitulate
DR Spell Check #5
Jennifer Jenkins
Thursday Jul 9, 2026
8th Grade
DR Spell Check #4
aggression circumscribe contradict edict facsimile geothermal hypercritical inaudible incredulous interrupt microsurgery monotonyopportune protract quadruped quintessence retrospect telecommunication trajectory tricentennial
DR Spell Check #4
Jennifer Jenkins
Thursday Jul 9, 2026
8th Grade
DR Spell Check #3
allege artifice autumnal centrality conceive condemnation defamatory defamatory fragility harmoniousimpediment impugn mediocre obsolescent paginateparadigm perspicacious precision prejudicial proclamation prohibition pugnaciousreciprocity reptilian rigidity
DR Spell Check #3
Jennifer Jenkins
Thursday Jul 9, 2026
8th Grade
DR Spell Check #2
decisiondepression electionerosion generationillustrationlocation musician objection permission possessionreduction
DR Spell Check #2
Jennifer Jenkins
Thursday Jul 9, 2026
8th Grade
DR Spell Check #1
attentivenessbreathlessdisengage disorderfriendliness fruitlessmisconductmurkierpreexisting preoccupiedpreoccupied respectfulrigorousness tactlessnessunattached
DR Spell Check #1
Michelle Paul
Thursday Jul 9, 2026
The Boy Who Cried Wolf
Charleroifedmetpanransatwolf
The Boy Who Cried Wolf
Thursday Jul 9, 2026
Unit1
BookMarkerPenPencilRuler
Thursday Jul 9, 2026
7th Grade
Dictation 2
Superior (adj.) acceleration. (n.)assumption (n.)biomechanics (n.)continent (n.)culture (n.)dissolve (v.)friction (n.)hypertrophy (n.)ideology (n.) muscular (adj.)peel (v.)relationship (n.)stamina (n.)systematically (adv.)transparent (adj.)
Tatiana Patton
Wednesday Jul 8, 2026
4th Grade
Abeka Spelling List 2: Thessalonians 5:18
ArizonaArkansasRedeemerargumentbargainbelievablebreathedecentdefinitiondevelopeightyfamiliargratitudeinvolvemischiefneighboromnipotentpeopleprinciplequotientreceiptreignsecuritysteepleutensil
Abeka Spelling List 2: Thessalonians 5:18
Tatiana Patton
Wednesday Jul 8, 2026
4th Grade
Spelling List 1: Proverbs 18:24
AlabamaAlaskaactuallybreakablebriefcarelessnessceilingcreativitydangerousdeceiveemergencyeternalexperiencefriendlinessknowledgeminutenecessaryoccurorganizeprincipalrecessreliefrespectfulstainedvolcano
Spelling List 1: Proverbs 18:24
Tatiana Patton
Wednesday Jul 8, 2026
4th Grade
Spelling List 1: Proverbs 18:24
AlabamaAlaskaactuallybreakablebriefcarelessnessceilingcreativitydangerousdeceiveemergencyeternalexperiencefriendlinessknowledgeminutenecessaryoccurorganizeprincipalrecessreliefrespectfulstainedvolcano
Spelling List 1: Proverbs 18:24
Tatiana Patton
Wednesday Jul 8, 2026
4th Grade
Spelling List 1: Proverbs 18:24
AlabamaAlaskaactuallybreakablebriefcarelessnessceilingcreativitydangerousdeceiveemergencyeternalexperiencefriendlinessknowledgeminutenecessaryoccurorganizeprincipalrecessreliefrespectfulstainedvolcano
Abeka 4th Grade Spelling List 1
Wednesday Jul 8, 2026
Spelling Homework
fineflyingideaknightshinywhite
Wednesday Jul 8, 2026
8th Grade
Spelling test unit 34 Grade 7
able-bodiedabsent-mindedair-conditionedaudio-visualbookkeepercopyrighteyewitnesshandlebarsloose-leafmotorcyclenine-hundredthspart-timequarterbackself-sacrificespacecraftthree-fourthsthroughouttwenty-ninetwo-thousandthsvineyard
Amy W
Wednesday Jul 8, 2026
8th Grade
Spelling #2 ee and ea have the long sound of e
greasekneedleechseemsmearspeaksweet pea
ee and ea have the long sound of e
Bobjane Ashby
Wednesday Jul 8, 2026
5th Grade
ColumnNiecePressureScientistStatue
Jennifer Jenkins
Wednesday Jul 8, 2026
6th Grade
S&A Sort #56
AfricaAmericaAmericaAntarcticaArcticAsiaAtlantic AustraliaEuropeIndianPacificclimatecontinent environmentequatorgeographyhemisphere informationislandoceanpeninsulapopulationtemperaturetropical
S&A Sort #56
Jennifer Jenkins
Wednesday Jul 8, 2026
6th Grade
S&A Sort #55
beliefceilingconceitdeceiveeighteeneitherfreightgriefmischiefneighborneitherniecepriestreceiptreceivereignrelieveseizeshieldsleighthiefweighweirdyield
S&A Sort #55
Jennifer Jenkins
Wednesday Jul 8, 2026
5th Grade
S&A Sort #55
beliefceilingconceitdeceiveeighteeneitherfreightgriefmischiefneighborneitherniecepriestreceiptreceivereignrelieveseizeshieldsleighthiefweighweirdyield
S&A Sort #55
Jennifer Jenkins
Wednesday Jul 8, 2026
6th Grade
S&A Sort #54
conductconduct contractcontractdesertdesert exportexport objectobjectpermitpermitpresentpresentproduceproducerebelrebelrecordrecordrejectrejectsubjectsubject
S&A Sort #54
Jennifer Jenkins
Wednesday Jul 8, 2026
6th Grade
S&A Sort #53
allowedaloudberryboardbored burycellarchews choosedesertdessert flourflowerhigherhiremarrymedal merry metalsellertheir therethey'revary veryweather whether
S&A Sort #53
Jennifer Jenkins
Wednesday Jul 8, 2026
6th Grade
S&A Sort #52
carelessnesscolorful darknessdreadful faithfulfearfulgoodnessgraceful happiness harmlesshelplessnesshomelesshopelessillnesskindnesspainfulpeacefulnesspennilessplentifulrestlessthankfulnessthoughtfulweaknessworthless
S&A Sort #52
Jennifer Jenkins
Wednesday Jul 8, 2026
6th Grade
S&A Sort #51
braverbravestcalmercalmestcloserclosestcoolercoolest crazier craziest dirtierdirtiest easiereasiest happierhappiesthotter hottest prettierprettieststrongerstrongestweaker weakest
S&A Sort #51
Jennifer Jenkins
Wednesday Jul 8, 2026
6th Grade
S&A Sort #50
angrily breezy chilly clearly cloudy daily dimlyeasily foggy happily lazily loudly misty noisily quickly quietly rainy roughly slowlysmoothly snowystormy sunnywindy
S&A Sort #50
Jennifer Jenkins
Wednesday Jul 8, 2026
6th Grade
S&A Sort #49
October bicycle bilingual bisect biweeklyoctagon octopus pentagon quadrangle triangle tricycle trilogy trio triple triplet tripod unicorn unicycle uniform union unique unison united universe
S&A Sort #49
Jennifer Jenkins
Wednesday Jul 8, 2026
6th Grade
S&A Sort #48
exclaim excludeexit expand express extend extra forearm forecast forehead foremost foresee foreshadowincome incomplete incorrect indecent indent indoor insight nonfatnonfiction nonsense nonstop
S&A Sort #48
Jennifer Jenkins
Wednesday Jul 8, 2026
6th Grade
S&A Sort #47
disable disagreedisappear discomfortdiscover dishonest dislike disloyal disobey misbehavemisjudgemismatch misplace misspell mistreat precaution preciousprefix preheat premature preschoolpreteen pretest preview
S&A Sort #47
Jennifer Jenkins
Wednesday Jul 8, 2026
6th Grade
S&A Sort #46
rebuild recopy recycle refillremodel reptile retake retell retrace reuse review rewrite unable unbeaten uncertain uncle unequal uneven unfair unhappy unkind unselfish unsteady unusual
S&A Sort #46
Jennifer Jenkins
Wednesday Jul 8, 2026
6th Grade
S&A Sort #45
alphabet caught cough daughter dolphin elephant enough fought laughter naughty nephew orphan paragraph phantom phone phrasephysics rough taught tough triumph trophy
S&A Sort #45
Jennifer Jenkins
Wednesday Jul 8, 2026
6th Grade
S&A Sort #44
answer assign bought brought castle design fasten honest honor knowledge knuckle listen often resignrhyme rhythm softenthough thought through whistle wreckage wrestle wrinkle
S&A Sort #44
Jennifer Jenkins
Wednesday Jul 8, 2026
6th Grade
S&A Sort #43
antique banquet conquer equal frequent inquire liquid mosquito quaint quality queasy questionquiver quizzes racquet request require sequel sequence squeaky squirm squirrel technique tranquil
S&A Sort #43
Jennifer Jenkins
Wednesday Jul 8, 2026
6th Grade
S&A Sort #42
attack attic buckle chicken complex fabric frantic hammock index magic metric nickel perplex pickle picnic plastic pocket quick relax shock stomach ticket topic traffic
S&A Sort #42
G R
Wednesday Jul 8, 2026
6th Grade
E
charcoalcheerfullycollagecourtesycovenantcuriositydangerousdeacondedicationdenialdetourdiagnosis
E
Jennifer Jenkins
Wednesday Jul 8, 2026
6th Grade
S&A Sort #41
arguecatalogdialog fatigue gaugeguard guess guest guide guilty guitar iceberg intrigue ladybuglanguage league plague shrugstrong tonguevaguezigzag
S&A Sort #41
Jennifer Jenkins
Wednesday Jul 8, 2026
6th Grade
S&A Sort #40
actress address bandage budget compasscourage distance gadget garbage luggage manage message midget noticeoffice package police practice princess recess science sentence surgeon village
S&A Sort #40
Jennifer Jenkins
Wednesday Jul 8, 2026
6th Grade
S&A Sort #39
cementcentral century cereal cider circle collect collegecommoncontest correct custom cyclist garage gather general genius gentlegingerbread giraffe golden gossip gutter gymnast
S&A Sort #39
Jennifer Jenkins
Wednesday Jul 8, 2026
6th Grade
S&A Sort #38
afraid against agreed alongaloud among anotherawayawhilebecausebegun believebeneath betweenbeyond debatedefend degreedependdesiredevelopdirect divideupon
S&A Sort #38
Jennifer Jenkins
Wednesday Jul 8, 2026
6th Grade
S&A Sort #37
carried carriescarryingcopiedcopiescopying decayed decaying decays enjoyedenjoyingenjoyshurried hurries hurryingobeyed obeyingobeys replied repliesreplyingstudiedstudiesstudying
S&A Sort #37
Jennifer Jenkins
Wednesday Jul 8, 2026
6th Grade
S&A Sort #36
Julyberry body brownie candycherry cookiedenydizzy donkey eerie goalie journey moneymonkeymoviepinkie reply story turkey twenty valley veryvolley
S&A Sort #36
Jennifer Jenkins
Wednesday Jul 8, 2026
6th Grade
S&A Sort #35
balletbanditbuffetclimateclosetcometcreditedithabitjacketlimitmagnetmeritorbitpirateprivatequietracketrocketsecretsenatesummittargetunit
S&A Sort #35
Jennifer Jenkins
Wednesday Jul 8, 2026
6th Grade
S&A Sort #34
baconbargainbrokencabincaptainchosencottoncousincurtaindragonelevenfountaingallonheavenhiddenmissionmittenmountainmuffinnapkinpenguinprisonribbonstolen
S&A Sort #34
Jennifer Jenkins
Wednesday Jul 8, 2026
6th Grade
S&A Sort #33
capturecatchercreatureculturedangerfailurefigurefutureinjureleisuremeasuremixturenaturepasturepicturepitcherpleasureposturepressurerancherseniorteachertorturetreasure
S&A Sort #33
Jennifer Jenkins
Wednesday Jul 8, 2026
6th Grade
S&A Sort #32
actorbeggarbiggerbrighterburglardancerdreamerdriverfarmerfresherjoggerlongeroldersailorshoppersmallersmoothersoonerswimmertraitortutorvoterwriteryounger
S&A Sort #32
Jennifer Jenkins
Wednesday Jul 8, 2026
6th Grade
S&A Sort #31
collarcolorcoverdoctordollarfatherfavorflavorflowergrammarharbormirrormothermotorotherratherrumorsilversolarspidersugartractorunderweather
S&A Sort #31
Jennifer Jenkins
Wednesday Jul 8, 2026
6th Grade
S&A Sort #30
Aprilangelanglecancelcattlecoupleevilfinalfossilfragilejournallevellocalmetalmodelnovelpencilsaddlesignalspecialtotaltraveluntilvowel
S&A Sort #30
Jennifer Jenkins
Wednesday Jul 8, 2026
6th Grade
S&A Sort #29
ableapplebattlebottlebridlebuglecablecandlecradlegigglehandlejunglelittlemiddlemusclepaddleriflesamplesettlesimplesingletabletitletremble
S&A Sort #29
Jennifer Jenkins
Wednesday Jul 8, 2026
6th Grade
S&A Sort #28
adhereappearcareercheerfuldrearyearlyearthquakehermitkernellearnermercymerelynearbypearlyrehearsesermonserpentseveresincerespearmintteardropthermosyearbookyearn
S&A Sort #28
Wednesday Jul 8, 2026
7th Grade
actuarial sciencebribeexpressionfidgetedforgienfoyerfuryinheritedjailbaitlegitmademoiselleordinaryphilanthropistrighteoussummons
Inheritence Games Book, Chapters 1-7
Jennifer Jenkins
Wednesday Jul 8, 2026
6th Grade
S&A Sort #27
Thursdaybirdbathbirthdaycertaindirtyduringeveryfirmlyfurnishfurtherhurrymermaidnervousperfectperhapspersonpurplepurposepurposeservicespiritthirstythirtyturtle
S&A Sort #27
Jennifer Jenkins
Wednesday Jul 8, 2026
6th Grade
S&A Sort #26
backwarddwarfquarrelquartersquabblesquadsquashsquatswarmwafflewanderwardenwardrobewarmthwarningwarriorwatchworkerworldworryworseworshipworthwhileworthy
S&A Sort #26
Jennifer Jenkins
Wednesday Jul 8, 2026
6th Grade
S&A Sort #25
adoreashorebeforeborderchoruscorncobcornerexplorefloristforestfortyignoreinformmorningnormalnorthernorderperformrecordreportrewardshortersorrystormy
S&A Sort #25
Jennifer Jenkins
Wednesday Jul 8, 2026
6th Grade
S&A Sort #24
airplaneawarebarberbarelybewarecarefulcarpetcarrycomparedairydeclaredespairfairygardenhaircuthardlyharvestmarblemarketpardonparentspartnerrepairtoward
S&A Sort #24
Wednesday Jul 8, 2026
6th Grade
Spelling 6th Grade 3
1. accuse (acusar)10. embarrass ( avergonzar)11. especially (especialmente)12. except (excepto)13. excuse (excusar)14. library (biblioteca)15. minute (minuto)16. nickel (moneda de 5 centavos)17. probably (probablemente)2. affect (afectar)3. beautiful (hermosa)4. bought (compró)5. busy (ocupado)6. caught (atrapó)7. different (diferente)8. done (hecho)9. effect (efecto)batherecommend (recomendar)remoteseparate (separar)their (su)there (allá)they’re (ellos/ellas son)trait
List 3 6th
Jennifer Jenkins
Wednesday Jul 8, 2026
6th Grade
S&A Sort #23
Augustall rightalmostalreadyalsoalthoughalwaysauctionauthorautumnawesomeawfulawkwardcautionfaucetflawlessgawkinggnawedhauntedlaughedlaundrylawyersaucersausage
S&A Sort #23
Jennifer Jenkins
Wednesday Jul 8, 2026
6th Grade
S&A Sort #22
aboutallowamountannoyappointaroundavoidcountercountrycountycowarddestroydoubledrowsyemployloyalmoisturenoisypoisonpowdersouthernthousandtroublevoyage
S&A Sort #22
Jennifer Jenkins
Wednesday Jul 8, 2026
6th Grade
S&A Sort #21
competedefeateasternextremefeatherfeaturefifteenfreedomhealthyheavyincreaseindeedleathermeaningneedlepeoplepleasantreaderrepeatseasonsteadysucceedsweaterthirteen
S&A Sort #21
Wednesday Jul 8, 2026
5th Grade
admirationangrilyappreciateawkwardbeginningconveniencecourageouscourteousdangerousdevelopforgottenhumourousjealousmedalmeddlemiddlemountainouspiecepoisonouspreparationsensationsensespontaneoustremendousvigorous
Wednesday Jul 8, 2026
acquaintanceamateurbiographicalcohesionconcurrentlyconsequentlyconsonancefurthermorehullabalooidiosyncrasyindigenousonomatopoeiaquatrainsynecdochetransition
Wednesday Jul 8, 2026
becambecoscamradifrentenuffrendhapylittelpeplepllaydruningsedsedyshudskoolsumswimingtharewichwot
Tuesday Jul 7, 2026
In My House
TVattic bathroombathtubbedbedroomclosetdining roomfridgegaragekitchenlaundry roomliving roomsinksofatoilet
Tuesday Jul 7, 2026
5th Grade
AccidentAthleteAttitudeBattleBecauseBoughtBroadBroughtCity ElephantEmptyFebruaryHappenImportantInchInstantInventJungleKitchenLobsterLossNecklacePerhapsProblemShuttleSoughtSpellStrawSweaterSwungTaughtTennesseeUltimateUmbrellaUntil
Tuesday Jul 7, 2026
4th Grade
buydrinkeyefindkindlifelightmypitchswimtrywhichwhilewhy
Tuesday Jul 7, 2026
3rd Grade
July week 1- a words
Julybatchfireworksgrademaskstagestampsummertheytrack
July 6 short and long a
Tuesday Jul 7, 2026
3rd Grade
-ar sound
Marchalarmalarmargueartistcardcarnivalcarpetfarmgardenharshharvest marketparkpartyremarksharpsparklestarstart
Tuesday Jul 7, 2026
5th Grade
FridayMondaySaturdaySundayThursdayTuesdayWednesdaycalendardailydatedaymonthlyscheduletodaytomorrowweekweekdayweekendweeklyyesterday
Jennifer Jenkins
Tuesday Jul 7, 2026
6th Grade
S&A Sort #20
Tuesdayamuseballoonbeautycartoonchewycocoonconfusecougardoodleexcusefewerincludejewelnoodlepolluteraccoonreducerefuseroosterscootershampootoothacheuseful
S&A Sort #20
Jennifer Jenkins
Tuesday Jul 7, 2026
6th Grade
S&A Sort #19
Europealoneapproachawokebelowbowlingcoastercomposedecodeerodeexplodehostessloaferlonelylonesomelowerownerpostageposterremotesoapysoldiersupposetoaster
S&A Sort #19
Jennifer Jenkins
Tuesday Jul 7, 2026
6th Grade
S&A Sort #18
advicearrivebesidebrightlycombinedecidedelightdescribedrivewayfavoriteforgivefrightenhigherhighwayinvitelightningmachineninetypoliteprovidesidewalkslightlysurprisesurvive
S&A Sort #18
Jennifer Jenkins
Tuesday Jul 7, 2026
6th Grade
S&A Sort #17
againamazeawakebasementbraceletchocolatecomplaincontaincrayondecayescapeexplainmaybemayormistakeobeypainterparadepavementpaymentrainbowraisinremaintoday
S&A Sort #17
Jennifer Jenkins
Tuesday Jul 7, 2026
6th Grade
S&A Sort #16
cleanedfadedfloatedgreetedhopinghoppinghuntedjokingleakinglettingneedednoddedpaintedpantingplottingquotedracingsavingshoutingskatedskippedtellingwinningwrapped
S&A Sort #16
Jennifer Jenkins
Tuesday Jul 7, 2026
6th Grade
S&A Sort #15
Englishathletechildrencompletecontrolcreatecrueldiet duetgianthalfwayhundredinspectkingdomkitchenlionmonstermushroompilgrimpoempoetpumpkinriottrial
S&A Sort #15
Tuesday Jul 7, 2026
celingdeceiveexperiencefriendlinessrelief
Jennifer Jenkins
Tuesday Jul 7, 2026
6th Grade
S&A Sort #14
easyfinishfrozenhumanhumorlazyleaderlemonmeetingminutemusicneverpeanutpilotplanetpresentreasonriversecondsevensneakerstudentvisitwagon
S&A Sort #14
Lindsay Gibson
Tuesday Jul 7, 2026
3rd Grade
LIst 2.6
Fridayafraidairplaneawaybraidcomplaindaytimeexplainmaybeobtainplayerrelaystraytrailwaist
Lindsay Gibson
Tuesday Jul 7, 2026
3rd Grade
List 2.8
avoidbridgebucketchilderaseexplainfinishinvitemaybepressroyalstretchsubjectsuddenthrill
Jennifer Jenkins
Tuesday Jul 7, 2026
6th Grade
S&A Sort #13
afterbetterblanketbottomchapterfemalefeverfingerfollowfunnyhappenmembermomentnumberonlypatternpillowproblemsilentsisterwaterwindowwinteryellow
S&A Sort #13
Jennifer Jenkins
Tuesday Jul 7, 2026
6th Grade
S&A Sort #12
busycrazydinerdinnerevenhappyhellokittenlaterlessonletteropenoverpaperpennypretty puppyrabbitrulersummersupersuppertigertiny
S&A Sort #12
Lindsay Gibson
Tuesday Jul 7, 2026
3rd Grade
List 2.7
avoidchoicecoildestroyemployenjoyjoyfulloiternoiseoilyoysterpointrejoinroyalspoil
Lindsay Gibson
Tuesday Jul 7, 2026
3rd Grade
LIst 2.4
basketblackcontestdistantfinishhabithappenhundredpublishshrinksubjectsubmitsuddentabletuntil
Jennifer Jenkins
Tuesday Jul 7, 2026
6th Grade
S&A Sort #11
anyoneanythingbesidecheckouteveryoneeverythingherselfhimselfinsideitselfmyselfnothingoutsidesidewayssomebodysomehowsomeonesomethingsometimesomewherethemselvesthroughout withoutyourself
S&A Sort #11
Jennifer Jenkins
Tuesday Jul 7, 2026
6th Grade
S&A Sort #10
bookcasebookmarkbookwormcookbookcountdowndaylightdownhilldownpourdownstairsdowntownflashlightheadacheheadfirstheadlightheadphoneheadstronglighthouselightweight scrapbooksnowflakesnowmansnowplowsnowstormsunlight
S&A Sort #10
Lindsay Gibson
Tuesday Jul 7, 2026
3rd Grade
LIst 2.3
blissflossflufffootballfuzzgrassjazzypressshellsmallsniffstaffthrillunlesswhiff
Lindsay Gibson
Tuesday Jul 7, 2026
3rd Grade
LIst 2.2
backpackbadgebridgebucketcheckclockgadgetjacketjudgelodgepledgequickshockstickwedge
Jennifer Jenkins
Tuesday Jul 7, 2026
6th Grade
S&A Sort #9
criedcriescrycryingfriedfriesfryfryingplayplayedplayingplaysspiedspiesspraysprayedsprayingspraysspyspyingstaystayedstayingstays
S&A Sort #9
Lindsay Gibson
Tuesday Jul 7, 2026
3rd Grade
List 2.1
batchbleachbranchchampchantchartchestchildclutchdrenchglitchkitchenlunchstretchteach
Jennifer Jenkins
Tuesday Jul 7, 2026
6th Grade
S&A Sort #6
bledbleeddrawdrewdrivedrovefreezefrozekeepkeptknewknowsaidsayshineshonesleepsleptslidslidesweepsweptthrewthrow
Jennifer Jenkins
Tuesday Jul 7, 2026
6th Grade
S&A Sort #8
deerfeetfootgeesegooseknifeknivesleafleaveslifelivesloafloavesmicemousesheepteethtoothwifewiveswolfwolveswomanwomen
S&A Sort #8
Jennifer Jenkins
Tuesday Jul 7, 2026
6th Grade
S&A Sort #7
ashesbenchesbranchesbrusheschangeschurchesclassesclothescrashesditchesfoxesguesseshorseskissesleashesmixespeachesplacesscratchessketchesspeechessplashesvoiceswatches
S&A Sort #7
Jennifer Jenkins
Tuesday Jul 7, 2026
5th Grade
S&A Sort #6
bledbleeddrawdrewdrivedrovefreezefrozekeepkeptknewknowsaidsayshineshonesleepsleptslidslidesweepsweptthrewthrow
S&A Sort #6
Jennifer Jenkins
Tuesday Jul 7, 2026
6th Grade
S&A Sort #5
actedchewedcloseddroppedgrabbedhelpedhopedhoppedjoinedlivedmixednamednoddedpassedplannedsavedscoredseemedshoutedstartedsteppedstirredwaitedwanted
S&A Sort #5
Jennifer Jenkins
Tuesday Jul 7, 2026
6th Grade
S&A Sort #3
cleancleaningcloseclosingdreamdreamingeateatinglooklookingmailmailingmoanmoaningskateskatingtradetradinguseusingwavewavingwritewriting
S&A Sort #3
Jennifer Jenkins
Tuesday Jul 7, 2026
6th Grade
S&A Sort #4
addingbeggingcomingcuttingfeelingfixingfloatinggoinggrinninghavinghikinghummingjogginglivingmovingpushingreadingsettingsnowingspellingstoppingtakingtalkingworking
S&ASort#4
Lindsay Gibson
Tuesday Jul 7, 2026
3rd Grade
List 1.8
basketbelongbringcabindolphingiftgrantmomentmonthoftenopenplantshelfspringthen
Lindsay Gibson
Tuesday Jul 7, 2026
3rd Grade
List 1.7
dolphinfreshgophergraphmonthnothingphonephotoshelfshiftshrinksplashthemthinkthunder
Playwire Advertisement