Level 3 i-e
Sunday
Apr 28, 2024
alivechimecrimedrivefirehireinsideprizeshinesmilespinewhile
Load
Year 7, Term 3, Spelling List 2
Sunday
Apr 28, 2024
adviceadvisebreathbreathedefinitelydevicethoughthoughtthrough
Load
Year 7, Term 3, Vocabulary List 1
Sunday
Apr 28, 2024
apologiesat your earliest convenienceconsiderconsiderablecontactdemandfurtherfurthermorehoweverinformmoreoverpositiverequire
Load
Sunday
Apr 28, 2024
AustraliaEgyptbureaucracycampaigncharacterdefinitelykindergartenliaisonnarrativepamphletphenomenalrestaurantsettingsilhouettesouvenir
Load
Term 2, Week 3, 2024 Mrs Auchter's Year 7
Sunday
Apr 28, 2024
accompanyaccumulateadjoiningadjournappreciateappropriatearidattentionattributedesertdessertdisorientateddissatisfiedsand dunessandy
Load
Unit 7: Ants in a Hurry
Joy Shen
Saturday
Apr 27, 2024
drinkhurrylaynibblesipsslowlyswallowwork
Load
Success 1 Lesson 4
Joy Shen
Saturday
Apr 27, 2024
anxiousfledfleelobbypipe upthrow a party
Load
sped 4/5 reading 641674
Saturday
Apr 27, 2024
asparagusblack bean'scabbagedried green bean'seggplant'sfish
Load
Kid Starter Week 2
Cherry
Saturday
Apr 27, 2024
chaircrayondeskelkeraserhappyhenpaperpensad
Load
sped 4/5 reading 641672-1085085-2grp
lillith
Saturday
Apr 27, 2024
confiscate tv privilege's for a month from dj. and lillithconfiscate tv privilege's for awhile from dj. and lilithconfiscate tv privilege's for awhile from dj. and lillith.after sneaking into ghost zonecrydanny and samantha fenton confiscate dj. and lilith's tv privilege'sdanny and samantha fenton-phantom. ghost-human. or phantom fourm. feel uncomfortable punishing or disciplining mckenna or sophia. so they don't punish or discipline theire youngest babies. but instead. they just grab them gently by shoulder's. soft-gently kindly warn them "nono. that's wrong." clinge them tight for hug's and kisses. softly-gently tightly hold's them carefully with love's. and mentor them. and guide them with right from wrong. and give afew soft quick-gentle tap's on sholder-neartheire neck. and a talk on right from wrong. and they tell them "yall aren't in trouble. i know yall don't know any better. or yall don't know right or wrong. but. were alway's here to help you. and toteach you." and they give eachother alot of hug's and kissesdanny fenton had to confiscate dj's flipphone from scary sneaking stuntdanny fenton had to confiscate lilith's flipphonedanny fenton is severely disappointed in dj and lilithdanny fenton taking privilege's away from dj. and lilithdanny fenton trying to calm mckenna and sophia down from cryingdanny fenton-phantom trying to calm mckenna and sophia down from cryingdanny having serious talk with dj. and lilith about theire action'sdanny having serious talk with dj. and lilith about theire attitudedanny having serious talk with dj. and lilith about theire behaviordanny having serious talk with dj. and lilith about theire serious stunt they just pulleddanny having serious talk with dj. and lilith about theire situation of sneaking into ghost zonedanny phantom trying to calm mckenna and sophia down from cryingdanny, jr. and lilith fenton sneak's into ghost zone. parent's find's out. trouble ahead. 3 month's grounding. with no phone or electronic's-technology device's. no goin' out anywhere's but to school or ghost training or ghost emergencies. or ghost hunting with daddy. and no texting. if they wanna' talk to friend's it's either they visit at the fenton's house. or see eachother in school. or they write eachotherfighting fear with is a hard theme in sophia and mckenna fenton-phantomfighting fear with is a hard theme with sophia and mckenna fenton-phantomfighting fear with is hard for sophia and mckenna fenton-phantomfighting fear with is hard with sophia and mckenna fenton-phantomin a comic as a punishment for his dangerous actions, Danny decided to confiscate TV privileges for a whole month. from dj. and lillymckenna and sophia fenton are very shaken up in fearmckenna and sophia fenton are very shaken up with fearmckenna and sophia fenton cryingmckenna and sophia fenton severely scared. screaming. and crying. but are unknowingly and unintentionally slapping dj in fearmckenna and sophia fenton severely scared. screaming. and crying. but are unknowingly and unintentionally slapping dj in fear. daddy pull's him away. but then put's gentle hand's to the girl's wrist's. letting them know him. and mommy are here with themmckenna and sophia fenton take's a life-threatening fear during a frightening near death experience scare's them to death when dj. and lilith force's them to sneak into the ghost zone. mommy and daddy trie's calming them downmckenna and sophia fenton-phantom cryingmckenna and sophia phantom cryingparent's severely angry at dj. and lilithsamantha fenton give's afew medium forced hard slap's to dj. and lilith. to theire shouldier's for the scary stunt in the twin's. being involved in sneaking into ghost zoneserious talk with dj. and lilith about theire action'sserious talk with dj. and lilith about theire attitudeserious talk with dj. and lilith about theire behaviorserious talk with dj. and lilith about theire serious stunt they just pulledserious talk with dj. and lilith about theire situation of involving theire twin baby sister's: mckenna. and sophia. into sneaking off into ghost zonethe comic book ended on a cliffhanger when Danny Fenton had to confiscate DJ's flip phone due to some cryptic messages
Load
sped 4 reading 641671-1085080-jhch
lillith
Saturday
Apr 27, 2024
confiscate tv privilege's for a month from dj. and lillithconfiscate tv privilege's for awhile from dj. and lilithconfiscate tv privilege's for awhile from dj. and lillith.after sneaking into ghost zonecrydanny and samantha fenton confiscate dj. and lilith's tv privilege'sdanny fenton give's afew serious-forced hard slap's to dj. and lilith. to theire shouldier's for the scary stunt in the twin's. being involved in sneaking into ghost zonedanny fenton give's afew serious-forced hard slap's to dj. and lilith. to theire shouldier's for the scary stunt in the twin's. being involved in sneaking into ghost zone. he hated he had to do this to them. but he couldn't think anything to do. he'd been so severely angry at them for scaring the twin's. he had to punish them of someway in a disciplindanny fenton give's afew serious-forced sharp slap's to dj. and lilith. to theire shouldier's for the scary stunt in the twin's. being involved in sneaking into ghost zone. he hated he had to do this to them. but he couldn't think anything to do. he'd been so severely angry at them for scaring the twin's. he had to punish them of someway in a disciplindanny fenton had to confiscate dj's flipphone from scary sneaking stuntdanny fenton had to confiscate lilith's flipphonedanny fenton is severely disappointed in dj and lilithdanny fenton taking privilege's awayfrom dj. and lilithdanny fenton tell's dj. and lilith "there's serious lesson's. rightnow. you idiot's need to learn. before you can get you'r dang phone's back." this is upsetting to the kid'sdanny fenton tell's dj. and lilith "there's serious lesson's. rightnow. you idiot's need to learn. if you wan't you'r dang phone's back." this is upsetting to the kid'sdanny fenton trying to calm mckenna and sophia down from cryingdanny fenton-phantom trying to calm mckenna and sophia down from cryingdanny having serious talk with dj. and lilith about theire action'sdanny having serious talk with dj. and lilith about theire attitudedanny having serious talk with dj. and lilith about theire behaviordanny having serious talk with dj. and lilith about theire serious stunt they just pulleddanny having serious talk with dj. and lilith about theire situation of sneaking into ghost zonedanny phantom trying to calm mckenna and sophia down from cryingdanny, jr. and lilith fenton sneak's into ghost zone. parent's find's out. trouble ahead. 3 month's grounding. with no phone or electronic's-technology device's. no goin' out anywhere's but to school or ghost training or ghost emergencies. or ghost hunting with daddy. and no texting. if they wanna' talk to friend's it's either they visit at the fenton's house. or see eachother in school. or they write eachotherdj fenton in school gym. in anger of loosing phone privilege's. blowing off afew anger steam's. by playing basketball. luckily. daddy see's him practicing basketball. and offer's to help him. he ask's "do you need help. blow off you'r steam instead of anger or aggression over you'r own action's of scaring the twin's?" suprizingly dj accept's daddy's offer with answer "yes. go ahead." they play about a 3 hour's worth basketball match. and dj's anger is gone. daddy suprisingly give's him his phone back except in one condition with his phone. his wording: "here. but you'r still grounded." dj accept's. "uumm. o-ok? but i'm not mad anymore. i just hate losing privilege's. but thank's." daddy understand's this. they hug eachother. dj is happy tear's his phone privilege's are back. but danny has a word: "one condition. curfew 9:00pm phone up before then. instead of a 10:00pm usual bedtime. tech device's usually up before ten. you'r cerfewed." dj in sad face. accept's. to avoide. anything further. "aww. ok. i'll take. i don't wan't anything worse." daddy thank's him for accepting this conditionfighting fear with is a hard theme in sophia and mckenna fenton-phantomfighting fear with is a hard theme with sophia and mckenna fenton-phantomfighting fear with is hard for sophia and mckenna fenton-phantomfighting fear with is hard with sophia and mckenna fenton-phantomin a comic as a punishment for his dangerous actions, Danny decided to confiscate TV privileges for a whole month. from dj. and lillymckenna and sophia fenton are very shaken up in fearmckenna and sophia fenton are very shaken up with fearmckenna and sophia fenton severely scared. screaming. and crying. but are unknowingly and unintentionally slapping dj in fearmckenna and sophia fenton severely scared. screaming. and crying. but are unknowingly and unintentionally slapping dj in fear. daddy pull's him away. but then put's gentle hand's to the girl's wrist's. letting them know him. and mommy are here with themmckenna and sophia fenton take's a life-threatening fear during a frightening near death experience scare's them to death when dj. and lilith force's them to sneak into the ghost zone. mommy and daddy trie's calming them downparent's severely angry at dj. and lilithsamantha fenton give's afew medium forced hard slap's to dj. and lilith. to theire shouldier's for the scary stunt in the twin's. being involved in sneaking into ghost zonesamantha fenton give's afew medium forced hard slap's to dj. and lilith. to theire shouldier's for the scary stunt in the twin's. being involved in sneaking into ghost zone. she feel's bad she did itsamantha fenton give's afew medium forced hard slap's to dj. and lilith. to theire shouldier's for the scary stunt in the twin's. being involved in sneaking into ghost zone. she feel's bad she did this. but danny agree's they deserve it on them for scaring the twin's into this stuntserious consequencesserious talk with dj. and lilith about theire action'sserious talk with dj. and lilith about theire attitudeserious talk with dj. and lilith about theire behaviorserious talk with dj. and lilith about theire serious stunt they just pulledserious talk with dj. and lilith about theire situation of involving theire twin baby sister's: mckenna. and sophia. into sneaking off into ghost zonethe comic book ended on a cliffhanger when Danny Fenton had to confiscate DJ's flip phone due to some cryptic messages
Load
sped 4/5 reading 641670-1085084-gg15
lillith
Saturday
Apr 27, 2024
apple cider vinegar soaked asparagusblistered basil herb grilled violife-mexican style cheesie asparagus soupcajun style cayenne garlic sauce cinnamon-cider cilantro garlic powder sauce asparagusdeep south dish seafood asparaguseuropeean garlic style meatless-steaksauce asparagusfinland style meatless pepperoni pepperchini style garlic-pepper asparagus stewgreen bean's asparagushawaiian hibachi sauce hibuscus asparagusitalian style meatless sausage italian dressing asparagusjamickan style jalapeño asparaguskale spinach-turmeric turnipgreen asparaguslemon-lime garlic sauce vinegar garlic salt violife cheese asparagus stewmeatless chicken asparagus
Load
Letterland Unit 27
Saturday
Apr 27, 2024
feetfoothalfhalvesleafleaveslifelivesteethtoothwomanwomen
Load
Wk30 Weekly Spelling Packet
Saturday
Apr 27, 2024
FebruaryIndiaJanuarycerealdiaryidealiarlionmeteorperiodpianopoempoetquietradiorodeoscienceusualvideoviolin
Load
6 letters words beginning with scr-
Jennifer Powell
Saturday
Apr 27, 2024
scrapescrawlscreamscreenscrewsscribescrimpscriptscrollscrubs
Load
sped 4 reading 641665-1085078-mqdl
lillith
Saturday
Apr 27, 2024
confiscate tv privilege's for a monthconfiscate tv privilege's for awhileconfiscate tv privilege's for awhile from dj. and lilithcrycrypticcryptic messagesdanny and samantha fenton confiscate dj. and lilith's tv privilege'sdanny fenton give's afew serious-forced hard slap's to dj. and lilith. to theire shouldier's for the scary stunt in the twin's. being involved in sneaking into ghost zonedanny fenton give's afew serious-forced hard slap's to dj. and lilith. to theire shouldier's for the scary stunt in the twin's. being involved in sneaking into ghost zone. he hated he had to do this to them. but he couldn't think anything to do. he'd been so severely angry at them for scaring the twin's. he had to punish them of someway in a disciplindanny fenton give's afew serious-forced sharp slap's to dj. and lilith. to theire shouldier's for the scary stunt in the twin's. being involved in sneaking into ghost zone. he hated he had to do this to them. but he couldn't think anything to do. he'd been so severely angry at them for scaring the twin's. he had to punish them of someway in a disciplindanny fenton had to confiscate dj's flipphonedanny fenton had to confiscate lilith's flipphonedanny fenton is severely disappointed in dj and lilithdanny fenton taking privilege's awayfrom dj. and lilithdanny fenton trying to calm mckenna and sophia down from cryingdanny fenton-phantom trying to calm mckenna and sophia down from cryingdanny having serious talk with dj. and lilith about theire action'sdanny having serious talk with dj. and lilith about theire attitudedanny having serious talk with dj. and lilith about theire behaviordanny having serious talk with dj. and lilith about theire serious stunt they just pulleddanny having serious talk with dj. and lilith about theire situationdanny phantom trying to calm mckenna and sophia down from cryingdanny, jr. and lilith fenton sneak's into ghost zone. parent's find's out. trouble ahead. 3 month's grounding. with no phone or electronic's-technology device's. no goin' out anywhere's but to school or ghost training or ghost emergencies. or ghost hunting with daddy. and no texting. if they wanna' talk to friend's it's either they visit at the fenton's house. or see eachother in school. or they write eachotherfighting fear with is a hard theme in sophia and mckenna fenton-phantomfighting fear with is a hard theme with sophia and mckenna fenton-phantomfighting fear with is hard for sophia and mckenna fenton-phantomfighting fear with is hard with sophia and mckenna fenton-phantomin a comic as a punishment for his dangerous actions, Danny decided to confiscate TV privileges for a whole month. from dj. and lillymckenna and sophia fenton are very shaken up in fearmckenna and sophia fenton are very shaken up with fearmckenna and sophia fenton severely scared. screaming. and crying. but are unknowingly and unintentionally slapping dj in fearmckenna and sophia fenton severely scared. screaming. and crying. but are unknowingly and unintentionally slapping dj in fear. daddy pull's him away. but then put's gentle hand's to the girl's wrist's. letting them know him. and mommy are here with themmckenna and sophia fenton take's a life-threatening fear during a frightening near death experience scare's them to death when dj. and lilith force's them to sneak into the ghost zone. mommy and daddy trie's calming them downparent's severely angry at dj. and lilithsamantha fenton give's afew medium forced hard slap's to dj. and lilith. to theire shouldier's for the scary stunt in the twin's. being involved in sneaking into ghost zonesamantha fenton give's afew medium forced hard slap's to dj. and lilith. to theire shouldier's for the scary stunt in the twin's. being involved in sneaking into ghost zone. she feel's bad she did itsamantha fenton give's afew medium forced hard slap's to dj. and lilith. to theire shouldier's for the scary stunt in the twin's. being involved in sneaking into ghost zone. she feel's bad she did this. but danny agree's they deserve it on them for scaring the twin's into this stuntserious consequencesserious talk with dj. and lilith about theire action'sserious talk with dj. and lilith about theire attitudeserious talk with dj. and lilith about theire behaviorserious talk with dj. and lilith about theire serious stunt they just pulledserious talk with dj. and lilith about theire situationshaken up with fearthe comic book ended on a cliffhanger when Danny Fenton had to confiscate DJ's flip phone due to some cryptic messages
Load
sped 4 read ela 641664-1085074-m9vn
lillith
Saturday
Apr 27, 2024
basementconfiscateconfiscate tv privilege's for a monthconfiscate tv privilege's for a weekconfiscate tv privilege's for awhilecrydanny and samantha fenton confiscate dj. and lilith's tv privilege'sdanny fenton give's afew serious-forced hard slap's to dj. and lilith. to theire shouldier's for the scary stunt in the twin's. being involved in sneaking into ghost zonedanny fenton give's afew serious-forced hard slap's to dj. and lilith. to theire shouldier's for the scary stunt in the twin's. being involved in sneaking into ghost zone. he hated he had to do this to them. but he couldn't think anything to do. he'd been so severely angry at them for scaring the twin's. he had to punish them of someway in a disciplindanny fenton had to confiscate dj's flipphonedanny fenton had to confiscate lilith's flipphonedanny fenton is severely disappointed in dj and lilithdanny fenton taking privilege's awayfrom dj. and lilithdanny having serious talk with dj. and lilith about theire action'sdanny having serious talk with dj. and lilith about theire attitudedanny having serious talk with dj. and lilith about theire behaviordanny having serious talk with dj. and lilith about theire serious stunt they just pulleddanny having serious talk with dj. and lilith about theire situationdanny, jr. and lilith fenton sneak's into ghost zone. parent's find's out. trouble ahead. 3 month's grounding. with no phone or electronic's-technology device's. no goin' out anywhere's but to school or ghost training or ghost emergencies. or ghost hunting with daddy. and no texting. if they wanna' talk to friend's it's either they visit at the fenton's house. or see eachother in school. or they write eachotherfighting fear with is a hard theme in sophia and mckenna fenton-phantomfighting fear with is a hard theme with sophia and mckenna fenton-phantomfighting fear with is hard for sophia and mckenna fenton-phantomfighting fear with is hard with sophia and mckenna fenton-phantomfrightfrightenedfrighteningghost labghost zonemckenna and sophia fenton are very shaken up in fearmckenna and sophia fenton are very shaken up with fearmckenna and sophia fenton severely scared. screaming. and crying. but are unknowingly and unintentionally slapping dj in fearmckenna and sophia fenton severely scared. screaming. and crying. but are unknowingly and unintentionally slapping dj in fear. daddy pull's him away. but then put's gentle hand's to the girl's wrist's. letting them know him. and mommy are here with themmckenna and sophia fenton take's a life-threatening fear during a frightening near death experience scare's them to death when dj. and lilith force's them to sneak into the ghost zone. mommy and daddy trie's calming them downparent's severely angry at dj. and lilithsamantha fenton give's afew medium forced hard slap's to dj. and lilith. to theire shouldier's for the scary stunt in the twin's. being involved in sneaking into ghost zonesamantha fenton give's afew medium forced hard slap's to dj. and lilith. to theire shouldier's for the scary stunt in the twin's. being involved in sneaking into ghost zone. she feel's bad she did itsamantha fenton give's afew medium forced hard slap's to dj. and lilith. to theire shouldier's for the scary stunt in the twin's. being involved in sneaking into ghost zone. she feel's bad she did this. but danny agree's they deserve it on them for scaring the twin's into this stuntsevere angered parent'sseverely disappointedshaken up in fearshaken up with feartaking privilege's awaytaking thing's awaytextingwritting
Load
sped 4th reading 641663-1085073-4jb5
lillith
Saturday
Apr 27, 2024
confiscateconfiscate tv privilege's for a monthconfiscate tv privilege's for a weekconfiscate tv privilege's for awhileconfiscate tv privilege's untill further noticecrydanny and samantha discuss with lilith. her action's of involving mckenna. and sophia. into sneaking off into the ghost zonedanny and samantha fenton confiscate dj. and lilith's tv privilege'sdanny and samantha fenton confiscate tv privilege's untill further noticedanny fenton give's afew serious-forced hard slap's to dj. and lilith. to theire shouldier's for the scary stunt in the twin's. being involved in sneaking into ghost zonedanny fenton give's afew serious-forced hard slap's to dj. and lilith. to theire shouldier's for the scary stunt in the twin's. being involved in sneaking into ghost zone. he hated he had to do this to them. but he couldn't think anything to do. he'd been so severely angry at them for scaring the twin's. he had to punish them of someway in a disciplindanny fenton give's afew serious-forced hard slap's to dj. and lilith. to theire shouldier's for the scary stunt in the twin's. being involved in sneaking into ghost zone. he hated he had to do this to them. but he couldn't think anything to do. he'd been so severely angry at them for scaring the twin's. he had to punish them of someway in a discipline. samantha respectfully disagree's on sch harsh discipline. or hard smacking. but doe's agree they needed punished. she feel's atleast a medium-forced smacking on them would've been better for themdanny fenton taking privilege's awayfrom dj. and lilithdanny having serious talk with dj. and lilith about theire action'sdanny having serious talk with dj. and lilith about theire attitudedanny having serious talk with dj. and lilith about theire behaviordanny having serious talk with dj. and lilith about theire serious stunt they just pulleddanny having serious talk with dj. and lilith about theire situationdanny, jr. and lilith fenton sneak's into ghost zone. parent's find's out. trouble ahead. 3 month's grounding. with no phone or electronic's-technology device's. no goin' out anywhere's but to school or ghost training or ghost emergencies. or ghost hunting with daddy. and no texting. if they wanna' talk to friend's it's either they visit at the fenton's house. or see eachother in school. or they write eachotherdj and lilith fenton. apologize's to mckenna. and sophia. for scaring them. and for involving them into the ghost zone. they forgive themdj and lilith fenton. are forced by mommy and daddy to apologize to the twin girl's for scaring themdj fenton is staying in basement. with danny. and samantha. as they discuss his action's of scaring the twin'sfearfighting fear with is a hard theme in sophia and mckenna fenton-phantomfighting fear with is a hard theme with sophia and mckenna fenton-phantomfighting fear with is hard for sophia and mckenna fenton-phantomfighting fear with is hard with sophia and mckenna fenton-phantomfurther noticekitchen gadget'slilith fenton is sen't into 10 minute's time out. in her bedroom. as she wait's for mommy and daddy for discuss disciplinemckenna and sophia fenton are very shaken up in fearmckenna and sophia fenton are very shaken up with fearmckenna and sophia fenton severely scared. screaming. and crying. but are unknowingly and unintentionally slapping dj in fearmckenna and sophia fenton severely scared. screaming. and crying. but are unknowingly and unintentionally slapping dj in fear. daddy pull's him away. but then put's gentle hand's to the girl's wrist's. letting them know him. and mommy are here with themmckenna and sophia fenton take's a life-threatening fear during a frightening near death experience scare's them to death when dj. and lilith force's them to sneak into the ghost zone. mommy and daddy trie's calming them downmommy and daddy discuss with lilith. her action's of involving mckenna. and sophia. into sneaking off into the ghost zoneparent's severely angry at dj. and lilithsamantha fenton give's afew medium forced hard slap's to dj. and lilith. to theire shouldier's for the scary stunt in the twin's. being involved in sneaking into ghost zonesamantha fenton give's afew medium forced hard slap's to dj. and lilith. to theire shouldier's for the scary stunt in the twin's. being involved in sneaking into ghost zone. she feel's bad she did itsamantha fenton give's afew medium forced hard slap's to dj. and lilith. to theire shouldier's for the scary stunt in the twin's. being involved in sneaking into ghost zone. she feel's bad she did this. but danny agree's they deserve it on them for scaring the twin's into this stuntsevere angered parent'ssevere angry parent'sseverely disappointedshaken up in fearshaken up with fear
Load
sped 4th reading 641662-1085068-6qk2
lillith
Saturday
Apr 27, 2024
angry parent's at danny, jr. and lilith fenton. after sneaking into ghost zone. parent's find's out. trouble ahead. they get grounded. no tv. phone privilege's. or video game's. except for board game's. or card game's. mckenna and sophia screaming. and are crying. because scared. but theire hurt? with deep cut's on theire arm's. daddy see's them bleeding. he's shocked. he take's a look at theire arm's. and grab's his first aid kit. he warn's them "this is really gonna' burn girl's. i'm sorry. but i need to stitch this scratch on you'r arm's." they scream in pain. but lucky for him. he has a special power to ease pain so they can't feel anything during this time of need of using stitche's on theire arm's. but they barf. but then black out in gagging fearblack out in gagging fearconfiscateconfiscate tv privilege's for a monthconfiscate tv privilege's for a weekconfiscate tv privilege's for awhileconfiscate tv privilege's untill further noticecrydanny and samantha fenton confiscate dj. and lilith's tv privilege'sdanny and samantha fenton confiscating everything from dj. and lilithdanny fenton taking privilege's awayfrom dj. and lilithdanny, jr. and lilith fenton sneak's into ghost zone. parent's find's out. trouble ahead. 3 month's grounding. with no phone or electronic's-technology device's. no goin' out anywhere's but to school or ghost training or ghost emergencies. or ghost hunting with daddy. and no texting. if they wanna' talk to friend's it's either they visit at the fenton's house. or see eachother in school. or they write eachotherdj. and lilith fenton facing confiscation by mommy and daddydj. and lilith fenton. suffer loss of privilege's by mommy and daddy when theire in punishmentdj. and lilith getting all tech device's confiscated by mommy and daddyfearfighting fearfighting in fearfighting with fearfurther noticemckenna and sophia fenton are very shaken up in fearmckenna and sophia fenton are very shaken up with fearmckenna and sophia fenton take's a life-threatening fear during a frightening near death experience scare's them to death when dj. and lilith force's them to sneak into the ghost zone. mommy and daddy trie's calming them downseverely angered parent'sseverely angry parent'sshaken up in fearshaken up with fearuntill further notice
Load
Saturday
Apr 27, 2024
blownicenoseplayrainsametietreetryuse
Load
sped 4 reading 641660-1085066-fxlz
lillith
Saturday
Apr 27, 2024
angry parent's at danny, jr. and lilith fenton. after sneaking into ghost zone. parent's find's out. trouble ahead. they get grounded. no tv. phone privilege's. or video game's. except for board game's. or card game's. mckenna and sophia screaming. and are crying. because scared. but theire hurt? with deep cut's on theire arm's. daddy see's them bleeding. he's shocked. he take's a look at theire arm's. and grab's his first aid kit. he warn's them "this is really gonna' burn girl's. i'm sorry. but i need to stitch this scratch on you'r arm's." they scream in pain. but lucky for him. he has a special power to ease pain so they can't feel anything during this time of need of using stitche's on theire arm's. but they barf. but then black out in gagging fearbarfbarf in fearblack out in gagging fearcrydanny and samantha fenton confiscate dj. and lilith's tv privilege'sdanny and samantha fenton confiscating everything from dj. and lilithdanny fenton taking privilege's awayfrom dj. and lilithdanny, jr. and lilith fenton sneak's into ghost zone. parent's find's out. trouble ahead. 3 month's grounding. with no phone or electronic's-technology device's. no goin' out anywhere's but to school or ghost training or ghost emergencies. or ghost hunting with daddy. and no texting. if they wanna' talk to friend's it's either they visit at the fenton's house. or see eachother in school. or they write eachotherdj. and lilith fenton facing confiscation by mommy and daddydj. and lilith fenton. suffer loss of privilege's by mommy and daddy when theire in punishmentdj. and lilith getting all tech device's confiscated by mommy and daddygaggag in feargagginggagging in fear
Load
Unit 5 Week 4 Beyond Spelling
Charlotte Rissala
Saturday
Apr 27, 2024
bottomlessbreathlessceaselessdisobeyeerinesseffortlessemptinessfiercenessfondnessfoolishnessforgivenessharmlessmeaninglessmercilessmistrustmotionlessnumbnesspeacefulnesspreviewsleevelessstillnessthoughtlessnessvastnessweaknessweightlessness
Load
Unit 5 Week 4 Approaching Spelling
Charlotte Rissala
Saturday
Apr 27, 2024
bottomlessdarknessdisobeyeffortlessfearlessfondnessfoolishnessforgivenessfullnessgladnessgoodnesshappinessharmlesshopelessmistrustmotionlessneedlesspreviewrestlesssadnessstillnessthoughtlessnesstirelessweaknessweighlessness
Load
sped 4th grade ela 641657-1085059-wvwh
Saturday
Apr 27, 2024
angry parent's at danny, jr. and lilith fenton. after sneaking into ghost zone. parent's find's out. trouble ahead. they get grounded. no tv. phone privilege's. or video game's. except for board game's. or card game's. mckenna and sophia screaming. and are crying. because scared. but theire hurt? with deep cut's on theire arm's. daddy see's them bleeding. he's shocked. he take's a look at theire arm's. and grab's his first aid kit. he warn's them "this is really gonna' burn girl's. i'm sorry. but i need to stitch this scratch on you'r arm's." they scream in pain. but lucky for him. he has a special power to ease pain so they can't feel anything during this time of need of using stitche's on theire arm's. but they barf. but then black out in gagging fearbarfbarf in fearblack out in gagging fearconfiscateconfiscatedconfiscatingconfiscationcrydanny, jr. and lilith fenton sneak's into ghost zone. parent's find's out. trouble ahead. 3 month's grounding. with no phone or electronic's-technology device's. no goin' out anywhere's but to school or ghost training or ghost emergencies. or ghost hunting with daddy. and no texting. if they wanna' talk to friend's it's either they visit at the fenton's house. or see eachother in school. or they write eachothergaggag in feargagginggagging in fearloss of privilege'staking privilege's away
Load
sped 4th grade ela 641656-1085057-t8lf
lillith
Saturday
Apr 27, 2024
angry parent's at danny, jr. and lilith fenton. after sneaking into ghost zone. parent's find's out. trouble ahead. they get grounded. no tv. phone privilege's. or video game's. except for board game's. or card game's. mckenna and sophia screaming. and are crying. because scared. but theire hurt? with deep cut's on theire arm's. daddy see's them bleeding. he's shocked. he take's a look at theire arm's. and grab's his first aid kit. he warn's them "this is really gonna' burn girl's. i'm sorry. but i need to stitch this scratch on you'r arm's." they scream in pain. but lucky for him. he has a special power to ease pain so they can't feel anything during this time of need of using stitche's on theire arm's. but they barf. but then black out in gagging fearcrydanny and samantha severely disappointed in dj and lilith for scaring soph. and kennie by forcing them into ghost zonedanny and samantha severely disappointed in dj and lilith for scaring soph. and kennie by forcing them into ghost zone. severe 3 month grounding for dj and lily. everything in fun activities are grounded. can't leave home except for school. ghost training. or ghost emergencies. or ghost hunting with daddy. no texting. only visiting friend's during school. or they visit fenton home. or they write eachother. dj and lilith are stuck grounded in theire room with instead of theire usual bedtime. theire curfewed untill grounding is overdanny fenton, jrdanny, jr. and lilith fenton sneak's into ghost zone. and scare's mckenna. and sophia. by sneaking them into the ghost zone. parent's find's this out. are mad at dj. and lilith. but are worried about the twin'sdanny, jr. and lilith fenton sneak's into ghost zone. and scare's mckenna. and sophia. by sneaking them into the ghost zone. parent's find's this out. are mad at dj. and lilith. but are worried about the twin's. dj. and lily- 3 week grounding. kenna. or sophie. nothing. just check up from daddy. with hope's the girl's are ok. but mommy and daddy has a calm nondisciplinarian chat with them about theire scare they just haddanny, jr. and lilith fenton sneak's into ghost zone. and scare's mckenna. and sophia. by sneaking them into the ghost zone. parent's find's this out. are mad at dj. and lilith. but are worried about the twin's. dj. and lily- 3 week grounding. kenna. or sophie. nothing. just check up from daddy. with hope's the girl's are ok. daddy trie's calming the girl's down. walker help's. he diagnoses the twin's with ptsd. but mommy and daddy has a calm nondisciplinarian chat with them about theire scare they just haddanny, jr. and lilith fenton sneak's into ghost zone. and scare's mckenna. and sophia. by sneaking them into the ghost zone. parent's find's this out. are mad at dj. and lilith. but are worried about the twin's. dj. and lily- 3 week grounding. kenna. or sophie. nothing. just check up from daddy. with hope's the girl's are ok. daddy trie's calming the girl's down. walker help's. he diagnoses the twin's with ptsd. but mommy and daddy has a calm nondisciplinarian chat with them about theire trauma they just haddanny, jr. and lilith fenton sneak's into ghost zone. and scare's mckenna. and sophia. by sneaking them into the ghost zone. parent's find's this out. are mad at dj. and lilith. but are worried about the twin's. dj. and lily- 3 week grounding. kenna. or sophie. nothing. just check up from daddy. with hope's the girl's are ok. daddy trie's calming the girl's down. walker help's. he diagnoses the twin's with ptsd. but mommy and daddy has a calm nondisciplinarian chat with them about theire traumatic experience they just haddanny, jr. and lilith fenton sneak's into ghost zone. and scare's mckenna. and sophia. by sneaking them into the ghost zone. parent's find's this out. are mad at dj. and lilith. but are worried about the twin's. dj. and lily- 3 week grounding. kenna. or sophie. nothing. just check up from daddy. with hope's the girl's are ok. daddy trie's calming the girl's down. walker help's. he diagnoses the twin's with ptsd. but mommy and daddy has a calm nondisciplinarian chat with them about theire traumatic experience they just had. but they don't have any disciplinary action's given. just mommy and daddy trying to calm them downdanny, jr. and lilith fenton sneak's into ghost zone. and scare's mckenna. and sophia. by sneaking them into the ghost zone. parent's find's this out. are mad at dj. and lilith. but are worried about the twin's. dj. and lily- 3 week grounding. kenna. or sophie. nothing. just check up from daddy. with hope's the girl's are ok. daddy trie's calming the girl's down. walker help's. he diagnoses the twin's with ptsd. but mommy and daddy has a calm nondisciplinarian chat with them about theire traumatic experience they just had. but they don't have any disciplinary action's given. just mommy and daddy trying to calm them down. walker look's into a dairyfree classic galactosemia safe liquid medicen for the twin's severe ptsd. danny and samantha thank's him for thisdanny, jr. and lilith fenton sneak's into ghost zone. parent's find's out. trouble ahead. 3 month's grounding. with no phone or electronic's-technology device's. no goin' out anywhere's but to school or ghost training or ghost emergencies. or ghost hunting with daddy. and no texting. if they wanna' talk to friend's it's either they visit at the fenton's house. or see eachother in school. or they write eachotherdanny, jr. and lilith fenton sneak's into ghost zone. parent's find's out. trouble ahead. they get grounded for a month. no phone. tv. computer or laptop. no tablet device's. or video game's ipod. mp3's. or no hanging out with friend except for schooldanny, jr. and lilith fenton sneak's into ghost zone. parent's find's out. trouble ahead. they get grounded for a month. no phone. tv. computer or laptop. no tablet device's. or video game's ipod. mp3's. or no hanging out with friend except in schooldanny, jr. and lilith fenton sneak's into ghost zone. parent's find's out. trouble ahead. they get grounded. no tv. phone privilege's. or video game's. except for board game's. or card game'sdanny, jr. and lilith fenton sneak's into ghost zone. parent's find's out. trouble ahead. they get grounded. no tv. phone privilege's. or video game's. except for board game's. or card game'sdj and lilith fenton are a littlebit mad at mommy and daddy for only punishing them. for sneaking into ghost zone. but the twin's aren't involved in discipline. although mommy and daddy say's "you idiot's forcefully involved them into this!" they spink up a jealousy of mckenna and sophia during this actghost zonelilith fentonmckenna and sophia fenton having nightmare'smckenna and sophia fenton having nightmare's from dj and lily making them go into ghost zonemckenna and sophia fenton-phantom having nightmare's from dj and lily making them go into ghost zonemckenna and sophia phantom having nightmare's from dj and lily making them go into ghost zonenondisciplinary action on danny and samantha fenton's profoundly significantly disabled youngest kid's. twin daughter's: mckenna and sophia. just comforting voice's talking to them. tell them "it's ok girl's." and give's them gentle-nondisplinary comforting hit's to lower back. and talk of right from wrong. all with a verbal notice "you'r not in trouble. were just talking. i know you don't understand. or don't know any better. or you don't know right from wrong. you have schizophrenia. it's ok for this disorder kid's." but then guve's tight-warm hug's. and warm loving kisses on head and face. and they tell them theire ok. including tell's them everything's ok. they explain to the girl's theire not mad at them. or not disappointed in them. or not even angry at them. nor theire not getting onto them. theire just trying to help. teach. and mentor themnondisciplinary action on danny and samantha fenton's profoundly significantly disabled youngest kid's. twin daughter's: mckenna and sophia. just soft-gentle-verbal warning with soft-gentle voice's. gently nondisplinary tapping hitting theire back's. gentle-nondisplinary hitting to lower back. and sweet-warm comfort's. and warm comfortable loving-caring tight clinging-comforting hug's. and warm kisses to theire head and faceptsdptsd with mckenna and sophia fentonptsd with mckenna and sophia fenton-phantomptsd with mckenna and sophia phantomwalker find's dairyfree classic galactosemia safe liquid medicen for mckenna and sophia fenton-phantom's profound ptsd
Load
sped 4/5 reading 641655-1085055-lw3s
jennifer
Saturday
Apr 27, 2024
crydanny and samantha severely disappointed in dj and lilith for scaring soph. and kennie by forcing them into ghost zonedanny and samantha severely disappointed in dj and lilith for scaring soph. and kennie by forcing them into ghost zone. severe 3 month grounding for dj and lily. everything in fun activities are grounded. can't leave home except for school. ghost training. or ghost emergencies. or ghost hunting with daddy. no texting. only visiting friend's during school. or they visit fenton home. or they write eachother. dj and lilith are stuck grounded in theire room with instead of theire usual bedtime. theire curfewed untill grounding is overdanny, jr. and lilith fenton sneak's into ghost zone. and scare's mckenna. and sophia. by sneaking them into the ghost zone. parent's find's this out. are mad at dj. and lilith. but are worried about the twin'sdanny, jr. and lilith fenton sneak's into ghost zone. and scare's mckenna. and sophia. by sneaking them into the ghost zone. parent's find's this out. are mad at dj. and lilith. but are worried about the twin's. dj. and lily- 3 week grounding. kenna. or sophie. nothing. just check up from daddy. with hope's the girl's are ok. but mommy and daddy has a calm nondisciplinarian chat with them about theire scare they just haddanny, jr. and lilith fenton sneak's into ghost zone. and scare's mckenna. and sophia. by sneaking them into the ghost zone. parent's find's this out. are mad at dj. and lilith. but are worried about the twin's. dj. and lily- 3 week grounding. kenna. or sophie. nothing. just check up from daddy. with hope's the girl's are ok. daddy trie's calming the girl's down. walker help's. he diagnoses the twin's with ptsd. but mommy and daddy has a calm nondisciplinarian chat with them about theire scare they just haddanny, jr. and lilith fenton sneak's into ghost zone. and scare's mckenna. and sophia. by sneaking them into the ghost zone. parent's find's this out. are mad at dj. and lilith. but are worried about the twin's. dj. and lily- 3 week grounding. kenna. or sophie. nothing. just check up from daddy. with hope's the girl's are ok. daddy trie's calming the girl's down. walker help's. he diagnoses the twin's with ptsd. but mommy and daddy has a calm nondisciplinarian chat with them about theire trauma they just haddanny, jr. and lilith fenton sneak's into ghost zone. and scare's mckenna. and sophia. by sneaking them into the ghost zone. parent's find's this out. are mad at dj. and lilith. but are worried about the twin's. dj. and lily- 3 week grounding. kenna. or sophie. nothing. just check up from daddy. with hope's the girl's are ok. daddy trie's calming the girl's down. walker help's. he diagnoses the twin's with ptsd. but mommy and daddy has a calm nondisciplinarian chat with them about theire traumatic experience they just haddanny, jr. and lilith fenton sneak's into ghost zone. and scare's mckenna. and sophia. by sneaking them into the ghost zone. parent's find's this out. are mad at dj. and lilith. but are worried about the twin's. dj. and lily- 3 week grounding. kenna. or sophie. nothing. just check up from daddy. with hope's the girl's are ok. daddy trie's calming the girl's down. walker help's. he diagnoses the twin's with ptsd. but mommy and daddy has a calm nondisciplinarian chat with them about theire traumatic experience they just had. but they don't have any disciplinary action's given. just mommy and daddy trying to calm them downdanny, jr. and lilith fenton sneak's into ghost zone. and scare's mckenna. and sophia. by sneaking them into the ghost zone. parent's find's this out. are mad at dj. and lilith. but are worried about the twin's. dj. and lily- 3 week grounding. kenna. or sophie. nothing. just check up from daddy. with hope's the girl's are ok. daddy trie's calming the girl's down. walker help's. he diagnoses the twin's with ptsd. but mommy and daddy has a calm nondisciplinarian chat with them about theire traumatic experience they just had. but they don't have any disciplinary action's given. just mommy and daddy trying to calm them down. walker look's into a dairyfree classic galactosemia safe liquid medicen for the twin's severe ptsd. danny and samantha thank's him for thisdanny, jr. and lilith fenton sneak's into ghost zone. parent's find's out. trouble aheaddanny, jr. and lilith fenton sneak's into ghost zone. parent's find's out. trouble ahead. 3 month's grounding. with no phone or electronic's-technology device's. no goin' out anywhere's but to school or ghost training or ghost emergencies. or ghost hunting with daddy. and no texting. if they wanna' talk to friend's it's either they visit at the fenton's house. or see eachother in school. or they write eachotherdanny, jr. and lilith fenton sneak's into ghost zone. parent's find's out. trouble ahead. they get grounded for a month. no phone. tv. computer or laptop. no tablet device's. or video game's ipod. mp3's. or no hanging out with friend except for schooldanny, jr. and lilith fenton sneak's into ghost zone. parent's find's out. trouble ahead. they get grounded for a month. no phone. tv. computer or laptop. no tablet device's. or video game's ipod. mp3's. or no hanging out with friend except in schooldanny, jr. and lilith fenton sneak's into ghost zone. parent's find's out. trouble ahead. they get grounded. no tv. phone privilege's. or video game's. except for board game's. or card game'sdj and lilith fenton are a littlebit mad at mommy and daddy for only punishing them. for sneaking into ghost zone. but the twin's aren't involved in discipline. although mommy and daddy say's "you idiot's forcefully involved them into this!" they spink up a jealousy of mckenna and sophia during this actnondisciplinary action on danny and samantha fenton's profoundly significantly disabled youngest kid's. twin daughter's: mckenna and sophia. just comforting voice's talking to them. tell them "it's ok girl's." and give's them gentle-nondisplinary comforting hit's to lower back. and talk of right from wrong. all with a verbal notice "you'r not in trouble. were just talking. i know you don't understand. or don't know any better. or you don't know right from wrong. you have schizophrenia. it's ok for this disorder kid's." but then guve's tight-warm hug's. and warm loving kisses on head and face. and they tell them theire ok. including tell's them everything's ok. they explain to the girl's theire not mad at them. or not disappointed in them. or not even angry at them. nor theire not getting onto them. theire just trying to help. teach. and mentor themnondisciplinary action on danny and samantha fenton's profoundly significantly disabled youngest kid's. twin daughter's: mckenna and sophia. just soft-gentle-verbal warning with soft-gentle voice's. gently nondisplinary tapping hitting theire back's. gentle-nondisplinary hitting to lower back. and sweet-warm comfort's. and warm comfortable loving-caring tight clinging-comforting hug's. and warm kisses to theire head and facewalker find's dairyfree classic galactosemia safe liquid medicen for mckenna and sophia fenton-phantom's profound ptsd
Load
Spelling Activity 1
Raquel De leon
Saturday
Apr 27, 2024
agendaanniversaryattendballballooncakecelebrationcostumedancedebatedecorationetiquettefestivefireworkgiftguestinvitationmeetingmusicparadepartyreunionspeechtoasttradition
Load
sped 4/5 reading 641653-1085053-ccbc
jennifer
Saturday
Apr 27, 2024
angrycrydanny, jr. and lilith fenton sneak's into ghost zonedanny, jr. and lilith fenton sneak's into ghost zone. and scare's mckenna. and sophia. by sneaking them into the ghost zonedanny, jr. and lilith fenton sneak's into ghost zone. and scare's mckenna. and sophia. by sneaking them into the ghost zone. parent's find's this out. are mad at dj. and lilith. but are worried about the twin'sdanny, jr. and lilith fenton sneak's into ghost zone. and scare's mckenna. and sophia. by sneaking them into the ghost zone. parent's find's this out. are mad at dj. and lilith. but are worried about the twin's. dj. and lily- 3 week grounding. kenna. or sophie. nothing. just check up from daddy. with hope's the girl's are. but mommy and daddy has a calm nondisciplinarian chat with them about theire scare they just haddanny, jr. and lilith fenton sneak's into ghost zone. parent's find's outdanny, jr. and lilith fenton sneak's into ghost zone. parent's find's out. trouble aheaddanny, jr. and lilith fenton sneak's into ghost zone. parent's find's out. trouble ahead. they get groundeddanny, jr. and lilith fenton sneak's into ghost zone. parent's find's out. trouble ahead. they get grounded for a monthdanny, jr. and lilith fenton sneak's into ghost zone. parent's find's out. wich mommy and daddy are mad at dj. and lily putting the twin's into neardeath danger. theire very disappointed int the kid's for scaring the twin'sdisappointedmadnondisciplinary action on danny and samantha fenton's profoundly significantly disabled youngest kid's. twin daughter's: mckenna and sophia. just comforting voice's talking to them. tell them "it's ok girl's." and give's them gentle-nondisplinary comforting hit's to lower back. and talk of right from wrong. all with a verbal notice "you'r not in trouble. were just talking. i know you don't understand. or don't know any better. or you don't know right from wrong. you have schizophrenia. it's ok for this disorder kid's." but then guve's tight-warm hug's. and warm loving kisses on head and face. and they tell them theire ok. including tell's them everything's ok. they explain to the girl's theire not mad at them. or not disappointed in them. or not even angry at them. nor theire not getting onto them. theire just trying to help. teach. and mentor themnondisciplinary action on danny and samantha fenton's profoundly significantly disabled youngest kid's. twin daughter's: mckenna and sophia. just soft-gentle-verbal warning with soft-gentle voice's. gently nondisplinary tapping hitting theire back's. gentle-nondisplinary hitting to lower back. and sweet-warm comfort's. and warm comfortable loving-caring tight clinging-comforting hug's. and warm kisses to theire head and face
Load
Saturday
Apr 27, 2024
aloftbuoyantchidecontenteminentharasshumiliationimperceptiblejauntmodestposthumouslyresolutescapegoatsimultaneousterrestrialuncouth
Load
sped 4/5 reading 641651-1085050-xczd
lillie
Saturday
Apr 27, 2024
crydanny and samantha fenton nondisciplinary talking to mckenna and sophiadanny and samantha fenton only use's soft-calm gentle verbal warning's on mckenna and sophiadanny and samantha fenton-phantom nondisciplinary talking to mckenna and sophiadanny and samantha fenton-phantom only use's soft-calm gentle verbal warning's on mckenna and sophiadanny and samantha phantom nondisciplinary talking to mckenna and sophiadanny and samantha phantom only use's soft-calm gentle verbal warning's on mckenna and sophianondisciplinary action on danny and samantha fenton's profoundly significantly disabled youngest kid's. twin daughter's: mckenna and sophianondisciplinary action on danny and samantha fenton's profoundly significantly disabled youngest kid's. twin daughter's: mckenna and sophia. just comforting voice's talking to them. tell them "it's ok girl's." and give's them gentle-nondisplinary comforting hit's to lower back. and talk of right from wrong. all with a verbal notice "you'r not in trouble. were just talking. i know you don't understand. or don't know any better. or you don't know right from wrong. you have schizophrenia. it's ok for this disorder kid's." but then guve's tight-warm hug's. and warm loving kisses on head and face. and they tell them theire ok. including tell's them everything's ok. they explain to the girl's theire not mad at them. or not disappointed in them. or not even angry at them. nor theire not getting onto them. theire just trying to help. teach. and mentor themnondisciplinary action on danny and samantha fenton's profoundly significantly disabled youngest kid's. twin daughter's: mckenna and sophia. just soft-gentle-verbal warning with soft-gentle voice's. gently nondisplinary tapping hitting theire back's. gentle-nondisplinary hitting to lower back. and sweet-warm comfort's. and warm comfortable loving-caring tight clinging-comforting hug's. and warm kisses to theire head and facenondisciplinary action on danny and samantha fenton's profoundly significantly disabled youngest kid's. twin daughter's: mckenna and sophia. just tight holding to theire waist. gently grab theire wrist's. take them down to mommy and or daddy's lap's to lay gently on stomach's as they gently tap theire shoulder's. give them soft-gentle-verbal warning with soft-gentle voice'snondisciplinary talking to mckenna and sophia fentonnondisciplinary talking to mckenna and sophia fenton-phantomnondisciplinary talking to mckenna and sophia phantomnondiscipline based talkingsoft-calm gentle verbal warning'ssoft-calm gentle verbal warning's on mckenna and sophia fentonsoft-calm gentle verbal warning's on mckenna and sophia fenton-phantomsoft-calm gentle verbal warning's on mckenna and sophia phantomsoft-kind calm gentle voice warning
Load
sped 4/5 reading 641650-1085048-hsln
lillie
Saturday
Apr 27, 2024
crydanny and samantha fenton nondisciplinary talking to mckenna and sophiadanny and samantha fenton-phantom nondisciplinary talking to mckenna and sophiadanny and samantha phantom nondisciplinary talking to mckenna and sophianondisciplinary action on danny and samantha fenton's profoundly significantly disabled youngest kid's. twin daughter's: mckenna and sophianondisciplinary action on danny and samantha fenton's profoundly significantly disabled youngest kid's. twin daughter's: mckenna and sophia. just comforting voice's talking to them. tell them "it's ok girl's." and give's them gentle-nondisplinary comforting hit's to lower back. and talk of right from wrong. all with a verbal notice "you'r not in trouble. were just talking. i know you don't understand. or don't know any better. or you don't know right from wrong. you have schizophrenia. it's ok for this disorder kid's." but then guve's tight-warm hug's. and warm loving kisses on head and face. and they tell them theire ok. including tell's them everything's ok. they explain to the girl's theire not mad at them. or not disappointed in them. or not even angry at them. nor theire not getting onto them. theire just trying to help. teach. and mentor themnondisciplinary action on danny and samantha fenton's profoundly significantly disabled youngest kid's. twin daughter's: mckenna and sophia. just soft-gentle-verbal warning with soft-gentle voice's. gently nondisplinary tapping hitting theire back's. gentle-nondisplinary hitting to lower back. and sweet-warm comfort's. and warm comfortable loving-caring tight clinging-comforting hug's. and warm kisses to theire head and facenondisciplinary action on danny and samantha fenton's profoundly significantly disabled youngest kid's. twin daughter's: mckenna and sophia. just tight holding to theire waist. gently grab theire wrist's. take them down to mommy and or daddy's lap's to lay gently on stomach's as they gently tap theire shoulder's. give them soft-gentle-verbal warning with soft-gentle voice'snondisciplinary talking to mckenna and sophia fentonnondisciplinary talking to mckenna and sophia fenton-phantomnondisciplinary talking to mckenna and sophia phantomnondiscipline based talking
Load
sped 4/5 reading 641649-1085046-3r23
lillie
Saturday
Apr 27, 2024
crydanny and samantha fentondanny and samantha fenton teaches theire twin's- mckenna. and sophia. not through punishment's. but through calm discussion'sdanny and samantha fenton-phantomdanny and samantha fenton-phantom teaches theire twin's- mckenna. and sophia. not through punishment's. but through calm discussion'sdanny and samantha phantomdanny and samantha phantom teaches theire twin's- mckenna. and sophia. not through punishment's. but through calm discussion'snondisciplinary action on danny and samantha fenton's profoundly significantly disabled youngest kid's. twin daughter's: mckenna and sophianondisciplinary action on danny and samantha fenton's profoundly significantly disabled youngest kid's. twin daughter's: mckenna and sophia. just tight holding to theire waist. gently grab theire wrist's. take them down to mommy and or daddy's lap's to lay gently on stomach's as they gently tap theire shoulder's. give them soft-gentle-verbal warning with soft-gentle voice's. gently nondisplinary tapping hitting theire back's. gentle-nondisplinary hitting to lower back. and sweet-warm comfort's. and warm comfortable loving-caring tight clinging-comforting hug's. and warm kisses to theire head and face. comforting voice's talking to them. tell them "it's ok girl's." and give's them gentle-nondisplinary comforting hit's to lower back. and talk of right from wrong. all with a verbal notice "you'r not in trouble. were just talking. i know you don't understand. or don't know any better. or you don't know right from wrong. you have schizophrenia. it's ok for this disorder kid's." but then guve's tight-warm hug's. and warm loving kisses on head and face. and they tell them theire ok. including tell's them everything's ok. they explain to the girl's theire not mad at them. or not disappointed in them. or not even angry at them. nor theire not getting onto them. theire just trying to help. teach. and mentor themnondisplinariannondisplinary mentornondisplinary mentoring
Load
sped 4/5 ela 641648
lillie
Saturday
Apr 27, 2024
danny and samantha fentondanny and samantha fenton-phantomdanny and samantha phantommutenondisciplinary action on danny and samantha fenton's profoundly significantly disabled youngest kid's. twin daughter's: mckenna and sophia. just tight holding to theire waist. gently grab theire wrist's. take them down to mommy and or daddy's lap's to lay gently on stomach's as they gently tap theire shoulder's. give them soft-gentle-verbal warning with soft-gentle voice's. gently nondisplinary tapping hitting theire back's. gentle-nondisplinary hitting to lower back. and sweet-warm comfort's. and warm comfortable loving-caring tight clinging-comforting hug's. and warm kisses to theire head and face. comforting voice's talking to them. tell them "it's ok girl's." and give's them gentle-nondisplinary comforting hit's to lower back. and talk of right from wrong. all with a verbal notice "you'r not in trouble. were just talking. i know you don't understand. or don't know any better. or you don't know right from wrong. you have schizophrenia. it's ok for this disorder kid's." but then guve's tight-warm hug's. and warm loving kisses on head and face. and they tell them theire ok. including tell's them everything's ok. they explain to the girl's theire not mad at them. or not disappointed in them. or not even angry at them. nor theire not getting onto them. theire just trying to help. teach. and mentor themnondisplinariannondisplinary mentornondisplinary mentoring
Load
sped 4/5 ela 641647-1085043-cv8t
lillie
Saturday
Apr 27, 2024
crydanny and samantha fenton never get's onto mckenna and sophiadanny and samantha fenton-phantom never get's onto mckenna and sophiadanny and samantha phantom never get's onto mckenna and sophiano disciplinenondisciplinarien toward's mckenna and sophia fentonnondisciplinarien toward's mckenna and sophia fenton-phantomnondisciplinarien toward's mckenna and sophia phantomnondisciplinary action on danny and samantha fenton's profoundly significantly disabled youngest kid's. twin daughter's: mckenna and sophia. just tight holding to theire waist. gently grab theire wrist's. take them down to mommy and or daddy's lap's to lay gently on stomach's as they gently tap theire shoulder's. give them soft-gentle-verbal warning with soft-gentle voice's. gently nondisplinary tapping hitting theire back's. gentle-nondisplinary hitting to lower back. and sweet-warm comfort's. and warm comfortable loving-caring tight clinging-comforting hug's. and warm kisses to theire head and face. comforting voice's talking to them. tell them "it's ok girl's." and give's them gentle-nondisplinary comforting hit's to lower back. and talk of right from wrong. all with a verbal notice "you'r not in trouble. were just talking. i know you don't understand. or don't know any better. or you don't know right from wrong. you have schizophrenia. it's ok for this disorder kid's." but then guve's tight-warm hug's. and warm loving kisses on head and face. and they tell them theire ok. including tell's them everything's ok. they explain to the girl's theire not mad at them. or not disappointed in them. or not even angry at them. nor theire not getting onto them. theire just trying to help. teach. and mentor themnondisciplinary action on danny and samantha fenton-phantom's profoundly significantly disabled youngest kid's. twin daughter's: mckenna and sophia. just tight holding to theire waist. gently grab theire wrist's. take them down to mommy and or daddy's lap's to lay gently on stomach's as they gently tap theire shoulder's. give them soft-gentle-verbal warning with soft-gentle voice's. gently nondisplinary tapping hitting theire back's. gentle-nondisplinary hitting to lower back. and sweet-warm comfort's. and warm comfortable loving-caring tight clinging-comforting hug's. and warm kisses to theire head and face. comforting voice's talking to them. tell them "it's ok girl's." and give's them gentle-nondisplinary comforting hit's to lower back. and talk of right from wrong. all with a verbal notice "you'r not in trouble. were just talking. i know you don't understand. or don't know any better. or you don't know right from wrong. you have schizophrenia. it's ok for this disorder kid's." but then guve's tight-warm hug's. and warm loving kisses on head and face. and they tell them theire ok. including tell's them everything's ok. they explain to the girl's theire not mad at them. or not disappointed in them. or not even angry at them. nor theire not getting onto them. theire just trying to help. teach. and mentor themnondisciplinary action on danny and samantha phantom's profoundly significantly disabled youngest kid's. twin daughter's: mckenna and sophia. just tight holding to theire waist. gently grab theire wrist's. take them down to mommy and or daddy's lap's to lay gently on stomach's as they gently tap theire shoulder's. give them soft-gentle-verbal warning with soft-gentle voice's. gently nondisplinary tapping hitting theire back's. gentle-nondisplinary hitting to lower back. and sweet-warm comfort's. and warm comfortable loving-caring tight clinging-comforting hug's. and warm kisses to theire head and face. comforting voice's talking to them. tell them "it's ok girl's." and give's them gentle-nondisplinary comforting hit's to lower back. and talk of right from wrong. all with a verbal notice "you'r not in trouble. were just talking. i know you don't understand. or don't know any better. or you don't know right from wrong. you have schizophrenia. it's ok for this disorder kid's." but then guve's tight-warm hug's. and warm loving kisses on head and face. and they tell them theire ok. including tell's them everything's ok. they explain to the girl's theire not mad at them. or not disappointed in them. or not even angry at them. nor theire not getting onto them. theire just trying to help. teach. and mentor themnondiscipline
Load
Leo Vocabulary Words April 29
Saturday
Apr 27, 2024
disagreedisappeardisconnectdishonestdislikedispleasedistractunableunhappyunknownunusedunveil
Load
sped 4/5 reading 641645-1085032-kbh1
Saturday
Apr 27, 2024
mostly mutemostly mute-semi verbalmutenondisciplinary action on danny and samantha fenton's profoundly significantly disabled youngest kid's. twin daughter's: mckenna and sophianondisciplinary action on danny and samantha fenton's youngest kid's. twin daughter's: mckenna and sophianondisciplinary action on danny and samantha fenton-phantom's profoundly significantly disabled youngest kid's. twin daughter's: mckenna and sophianondisciplinary action on danny and samantha fenton-phantom's profoundly significantly disabled youngest kid's. twin daughter's: mckenna and sophia. just tight holding to theire waist. gently grab theire wrist's. take them down to mommy and or daddy's lap's to lay gently on stomach's as they gently tap theire shoulder's. give them soft-gentle-verbal warning with soft-gentle voice's. gently nondisplinary tapping hitting theire back's. gentle-nondisplinary hitting to lower back. and sweet-warm comfort's. and warm comfortable loving-caring tight clinging-comforting hug's. and warm kisses to theire head and face. comforting voice's talking to them. tell them "it's ok girl's." and give's them gentle-nondisplinary comforting hit's to lower back. and talk of right from wrong. all with a verbal notice "you'r not in trouble. were just talking. i know you don't understand. or don't know any better. or you don't know right from wrong. you have schizophrenia. it's ok for this disorder kid's." but then guve's tight-warm hug's. and warm loving kisses on head and face. and they tell them theire ok. including tell's them everything's oknondisciplinary action on danny and samantha fenton-phantom's youngest kid's. twin daughter's: mckenna and sophianondisciplinary action on danny and samantha phantom's profoundly significantly disabled youngest kid's. twin daughter's: mckenna and sophianondisciplinary action on danny and samantha phantom's youngest kid's. twin daughter's: mckenna and sophia
Load
sped reading 641644-1085020-yrb4
Saturday
Apr 27, 2024
jennifer fentonjennifer fenton has classic pkujennifer fenton has speech disorder'sjennifer fenton has speech impediment'sjennifer fenton is a stutter childjennifer fenton is levle 3 semi-mute autistic childmutesemi-mute
Load
Saturday
Apr 27, 2024
Oklahoma CityScissor-Tail Flycatcherbisonbuffalocapitaleaglefeathersflagflowerredbudregionsroseshieldsoonerstate
Load
sped 4/7 reading 641642-1085017-jql8
emily
Saturday
Apr 27, 2024
avocado dipchallengesclassic galactosemiaclassic pkucrycryokinesisdanny and samantha fenton help's mckenna. and sophia thinkdanny and samantha fenton help's mckenna. and sophia think of thing's. find's way's to help them understanddanny and samantha fenton help's mckenna. and sophia think. using thinking strategiesdanny and samantha fenton help's mckenna. and sophia think. using thinking technique strategiesdanny and samantha fenton help's mckenna. and sophia think. using thinking techniquesdanny fenton, jrdanny fenton-phantom teaching mckenna. and sophia cryokinesisdanny fenton-phantom teaching mckenna. and sophia cryokinesis. and how to use itdanny fenton-phantom teaching mckenna. and sophia to use cryokinesisdanny, jr (dj). lilith (lily). erick. andrew. jacob (jake). jennifer (jennie). jackson. and misty. and mckenna (kennie. or kenna). and sophia (soph. or sophie). are all danny. and samantha fenton's kid'sdanny, jr. lilith. erick. andrew. jacob. jennifer. jackson. and misty. and mckenna. and sophia. are all danny. and samantha fenton's kid'sdauntingdaunting challengesfeargalactosemiagrilled onion'sjennifer fenton was born premature. and was born with classic pku. and is a stutter. and has speech impediment's. and she's medium-level 3 semi verbal-nonverbal autistic. she's mostly mute due to stutter'slillithmckenna and sophia fentonmckenna and sophia fenton-phantommckenna and sophia fenton-phantom are too dangerously profoundly disabled. they can't cook. or cut. mommy or daddy has to do the cooking or cuttingmckenna and sophia fenton-phantom are too dangerously profoundly disabled. they can't cook. or cut. mommy or daddy has to do the cooking or cutting. the twin's just pick's out whatever recipe or ingredient's they wanna' usemckenna and sophia phantomparsley-red pepper cayenne chickenparsley-red pepper cayenne grilled-roasted onion'sparsley-red pepper cayenne grilled-roasted veggie'sparsley-red pepper cayenne roasted-grilled onion'sparsley-red pepper pepricka-garlic and cinnamon roasted onion'sparsley-red pepper pepricka-garlic and cinnamon roasted veggie'spkuresiliencyroasted onion'sstrategiestechnique strategiestechnique'sthinking strategiesthinking techniquethinking technique strategiesthinking technique's
Load
Love That Dog Spelling/Vocabulary
Saturday
Apr 27, 2024
anonymouscautionchompflatterheavehonoredinspiremiraclepasturepublisherscreechsheltersortingsplatterstraggly totterywaggingwheelbarrow
Load
Saturday
Apr 27, 2024
OklahomaOregonbalancecalendarcougarcursorenormouseyelashesfoliageguesseshazardoushumorouslensespopularprefixesreasonableregularreplaceablesandwichessingular
Load
Gtxvx
Saturday
Apr 27, 2024
CakeFrogLeapThatTreeTwo
Load
Renee Hayes
Friday
Apr 26, 2024
besidesdressextrashoeshoesstreamtalkstinytrustwords
Load
Renee Hayes
Friday
Apr 26, 2024
arrestallowappointclaimdewdueefforteitherestateincludeinformationledgepositionprimaryrememberresultservespecialwhowhom
Load
sped 5th grade reading
lillie
Friday
Apr 26, 2024
cochlear implantcochlear implant devicecochlear implant hearingaidecrydanny and samantha fentondanny and samantha fenton agree’s with doctor’s on emergency ear surgery for theire twin babie’s mckenna and sophia. but. doctor’s need’s danny fenton to go into phantom to help with the babies. but he’s too scared. but he goe’s ghost and help’s out. use’s his ghost cllaw’s to cut above theire ear’s and put permanent-prosthetic eardrum-itc cochlear implant hearingaide devce’s. and an eardrum pacemaker device over theire artificial eardrum’s. so the ear’s can have constant-frequent check up-ear exam’s. but then stich up the ear’s from theire ear’s attached to the bone behind theire ear’s. danny feel’s bad. and traumatized he had to do this. he was forced into this surgery of thees babies. he never wanted to hurt themdanny and samantha fenton are shocked to hear theire infant newborn twin baby daughter’s: mckenna. and sophia. are born profoundly deafmute. and are born without eadrum’s. and would need an emergency permanent-prosthetic-eardrum-in the-ear-canal cocolar-implant hearingaide-ear surgery. wich really scare’s mommy and daddy. theire in profound shockdanny fentondanny fenton-phantomdanny phantomdeaf-mute fenton twin’s mckenna and sophiadeaf-mute fenton-phantom twin’s mckenna and sophiadeaf-mute phantom twin’s mckenna and sophiadepressiondrinking in shockdrinking in traumatic stressdrinking in traumatic stressdrinking out of schockdrinking out of traumadrinking out of traumatic stressdrinking while depresseddrinking while in depressiondrinking with depressiondrinking with shockdrinking with traumadrinking with traumatic stressfearmckenna and sophia fentonmckenna and sophia fenton-phantommckenna and sophia phantomprofound traumatic fearprofound traumatized stressfull fearsamantha fentonsamantha fenton-phantomsamantha phantomscaredsmoking in shocksmoking in traumatic stresssmoking out of shocksmoking out of traumasmoking out of traumatic stresssmoking with shocksmoking with traumasmoking with traumatic stress
Load
loris evelyn salina
Friday
Apr 26, 2024
absolutearenacomplimentdeliberatedensedominanthazardoushuddlenecessityoffendregainthorough
Load
sped 4/6 reading 641634-1084974-7krz
lillie
Friday
Apr 26, 2024
crydanny and samantha fenton agree’s with doctor’s on emergency ear surgery for theire twin babie’s mckenna and sophia. but. doctor’s need’s danny fenton to go into phantom to help with the babies. but he’s too scared. but he goe’s ghost and help’s out. use’s his ghost cllaw’s to cut above theire ear’s and put permanent-prosthetic eardrum-itc cochlear implant hearingaide devce’s. and an eardrum pacemaker device over theire artificial eardrum’s. so the ear’s can have constant-frequent check up-ear exam’s. but then stich up the ear’s from theire ear’s attached to the bone behind theire ear’s. danny feel’s bad. and traumatized he had to do this. he was forced into this surgery of thees babies. he never wanted to hurt themdanny and samantha fenton are shocked to hear theire infant newborn twin baby daughter’s: mckenna. and sophia. are born profoundly deafmute. and are born without eadrum’s. and would need an emergency permanent-prosthetic-eardrum-in the-ear-canal cocolar-implant hearingaide-ear surgery. wich really scare’s mommy and daddy. theire in profound shockdrinking in angerdrinking in feardrinking in stressdrinking in traumatic stressdrinking out of anxietydrinking out of depressiondrinking out of feardrinking out of ptsddrinking out of stressdrinking out of traumadrinking out of traumatic stressdrinking with depressiondrinking with ptsddrinking with traumadrinking with traumatic stresssmoking in angersmoking in fearsmoking in stresssmoking in traumatic stresssmoking out of anxietysmoking out of depressionsmoking out of fearsmoking out of ptsdsmoking out of stresssmoking out of traumasmoking out of traumatic stresssmoking with depressionsmoking with ptsdsmoking with traumasmoking with traumatic stress
Load
U11 W1
Katie Bozone
Friday
Apr 26, 2024
adjoiningannoyingavoidedboycottcorduroydeployeddisappointecologyemployeeespeciallyholeloyaltymoistureoystersparanoidrejoicesoybeantenderlointurquoisewhole
Load
Unit 11 Week 2
Katie Bozone
Friday
Apr 26, 2024
accountableallowanceannouncementastoundingbackgroundbelievebloodhoundboundariescounselorcowardlydismountdownloaddrownedempoweredenvironmentfavoritefoundationgrowledmouthwashtowering
Load
R4R Unit 8 Week 3
Friday
Apr 26, 2024
abandonachieveadeptalasamendbraverychucklegentlehumanhumanehurdlenobleraiserisestruggletendencytreatytrophy
Load
Rikki Tikki Tavi
Friday
Apr 26, 2024
BalancingBredBroodBungalowClenched Consolation Cunningly FractionImmensely Inherited Mourning ParalyzedPeculiar RevivedSavagelyScornfullyScuttledSplendidThicketsValiantVeranda
Load
Week 4/29
Friday
Apr 26, 2024
bewilderboycottcondemndeterioratefeeblemomentumrationreluctantsubsequenttrudge
Load
Friday
Apr 26, 2024
BlackBlueBrownColorsFloorGreen HeadLockOrangePinkPurple RedWhiteYellow
Load
Week 25
Karie Feng
Friday
Apr 26, 2024
airalwaysbothdelightfulespeciallyexamplegotgrouplifemightnextoftenpaperrunthose
Load
My Side 4
Friday
Apr 26, 2024
adornedbearingcomplaintconservationistsdevourfatigueferocityhumanityindignityingenuityinsulatingmomentumoriginatedoutwitplumageprecautionprobabilityquarryrenditionresoundingsensationalismserenadesuperbutterlywistfully
Load
My Side 3
Friday
Apr 26, 2024
abundancebackwateringcarcasschitteringevidentlyferociousfragrantfurtivelyhystericsluremaneuversmarksmanshipmembranepersonablepoachingpreenedprovokequarteredracketeerreassuredscuttledtarrytediousvengeancewinced
Load
sped 5th reading 641623-1084908-pb6n
Friday
Apr 26, 2024
architectautisticcrydanny fenton witness his and samantha's twin daughter's: mckenna. and sophia. drinking pickle juice. he think's to himself "oh, gosh! that's disgusting!" but then. he say's to them: "ok girl's. let me see it. i'll let yall drnk it." but he gag'sdanny fenton-phantom witness his and samantha's twin daughter's: mckenna. and sophia. drinking pickle juice. he think's to himself "oh, gosh! that's disgusting!" but then. he say's to them: "ok girl's. let me see it. i'll let yall drnk it." but he gag'sdanny phantom witness his and samantha's twin daughter's: mckenna. and sophia. drinking pickle juice. he think's to himself "oh, gosh! that's disgusting!" but then. he say's to them: "ok girl's. let me see it. i'll let yall drnk it." but he gag'sdepakotedrinking pickle juicemccormick style red pepper pepricka garlic and cinnamon rubbed meatless chicken n' cayenne pepper sauce soaked bell pepper vegan-sausage sauteed veggie'smckenna and sophia fenton are mutemckenna and sophia fenton-phantom are mutemckenna and sophia fenton-phantom are severely mute. using mute skill's- communicating silently to architect theire victoriesmckenna and sophia fenton-phantom enjoy's an occasional weekly pickle juice in a shotcupmckenna and sophia fenton-phantom. as mute's. may architect their victoriesmckenna and sophia fenton-phantom. take's depakotemckenna and sophia fenton-phantom. take's depakote for seizure disorder'smckenna and sophia fenton-phantom. take's depakote for seizure'smckenna and sophia phantom are mutemuteoccasional pickle juice in a shotcupoutshoutpickle juice in a shotcupshotcupshysilent samuraisilent samurai skill'ssilent samurai skills have the villains on the runverbal therapy for mckenna and sophia fentonverbal therapy for mckenna and sophia fenton-phantomverbal therapy for mckenna and sophia phantomverbal therapy for nonverbal autismvocal cord therapy for mckenna and sophia fentonvocal cord therapy for mckenna and sophia fenton-phantomvocal cord therapy for mckenna and sophia phantomvocal cord therapy for nonverbal autismvocal therapy for mckenna and sophia fentonvocal therapy for mckenna and sophia fenton-phantomvocal therapy for mckenna and sophia phantomvocal therapy for nonverbal autismweekly pickle juice in a shotcup
Load
Master before starting part 1
Friday
Apr 26, 2024
AreBeBoyForGoLookNoOfOhOrPutSaidSoTheTheyTo
Load
Friday
Apr 26, 2024
1 and 2 CorinthiansCelsius scaleFahrenheit scaleGalatians Jet streamTempestuousaridatmospherebalmybarometerblizzard blusteryclimaticcondensationcyclonedelugedroughtevaporationforecasthazyhumidityhurricanehygrometerice crystallightningmoistureprecipitationsqualltemperaturethermometertornadoestropicalturbulencetyphoonweathervane
Load
Cenella Lee
Friday
Apr 26, 2024
ADDITIONAUTUMNALCELEBRATIONCEREMONIALCHANNELCHILDRENFESTIVALFRECKLEFUNNELGENERATIONHOSPITALIMPORTANTNATIONRUSTLESCUTTLESUBTRACTIONTRAVELTRIALTRICKLEVOWELWOBBLE
Load
Mariposas Ch 16-18
Friday
Apr 26, 2024
amidstantibioticsassortmentbrimmingcynicalenamoredintricatelyiridescentluminousmeagermystifiedneglectnurturesoffspringproddingserenelysopapillassplendorsurrealtrampled
Load
sped 5th reading 641618-1084898-2rg7
jacie
Friday
Apr 26, 2024
crydanny and samantha fenton-phantom. ghost-human. or phantom fourm. feel uncomfortable punishing or disciplining mckenna or sophia. so they don't punish or discipline theire youngest babies. but instead. they just grab them gently by shoulder's. soft-gently kindly warn them "nono. that's wrong." clinge them tight for hug's and kisses. softly-gently tightly hold's them carefully with love's. and mentor them. and guide them with right from wrong. and give afew soft quick-gentle tap's on sholder-neartheire neck. and a talk on right from wrong. and they tell them "yall aren't in trouble. i know yall don't know any better. or yall don't know right or wrong. but. were alway's here to help you. and toteach you." and they give eachother alot of hug's and kissesmccormick style red pepper pepricka garlic and cinnamon rubbed meatless chicken n' cayenne pepper sauce soaked bell pepper vegan-sausage sauteed veggie'smckenna and sophia fenton-phantom enjoy's an occasional weekly pickle juice in a shotcupoccasionaloccasional pickle juice in a shotcupoccasionallyoccupationalpickle juice in a shotcupscoliosisseldomseldomlyshotcupspeech therapyverbal therapy for nonverbal autismvocal cord therapy for nonverbal autismvocal therapy for nonverbal autismweekly pickle juice in a shotcup
Load
Rosemarie Meza
Friday
Apr 26, 2024
engineersoftwaresorghumstimulasstraitssynthetictenacletendonterracesthermostattranspirationtrapizoidtrembletriathlontropospheretsumanitundratungstenvascularvertexverticalvictoriouslyvoguevollyballwetland
Load
Frequently Misspelled Words (Group 2)
Friday
Apr 26, 2024
alsoalwaysanythinganywayeveryonefirstoncereallywhilewhole
Load
Unit 4 Vocab
Nicolette Gramlick
Friday
Apr 26, 2024
airatmospherebiomebiospherecrustgeosphereglaciersground waterhuman impacthydrosphereinner corekingdomsliftingmantlemeteorologynitrogenouter coreozone layerrainforestsaltwatersoilsurface watertropospherewater vaporwind funnel
Load
UNIT 4 WEEK 5
Diona Kimbrell
Friday
Apr 26, 2024
antibioticaudibleaudienceaudioaudiobookaudiologistaudiologyaudiotapeaudiovisualauditoriumbiodegradablebiodiversitybiographerbiographybiologistbiologybiomebiopsybiosphereinaudiblemicrobiologistsymbiotic
Load
sped 5th reading 641613-1084884-qdxw
lillie
Friday
Apr 26, 2024
danny and samantha fenton-phantom. ghost-human. or phantom fourm. feel uncomfortable punishing or disciplining mckenna or sophia. so they don't punish or discipline theire youngest babies. but instead. they just grab them gently by shoulder's. soft-gently kindly warn them "nono. that's wrong." clinge them tight for hug's and kisses. softly-gently tightly hold's them carefully with love's. and mentor them. and guide them with right from wrong. and give afew soft quick-gentle tap's on sholder-neartheire neck. and a talk on right from wrong. and they tell them "yall aren't in trouble. i know yall don't know any better. or yall don't know right or wrong. but. were alway's here to help you. and toteach you." and they give eachother alot of hug's and kissesmckenna and sophia fenton burping really loud. danny (theire daddy) love's this. and think's it's funny of themmckenna and sophia fenton get's confused around unfamiliar thing's. people. place's or surrounding'smckenna and sophia fenton get's confused around unfamiliar thing's. people. place's or surrounding's. including situation'smckenna and sophia fenton love's eating pickle'smckenna and sophia fenton love's enjoying a weekly pickle icee's treatmckenna and sophia fenton-phantom burping really loud. danny (theire daddy) love's this. and think's it's funny of themmckenna and sophia fenton-phantom enjoy's an occasional weekly pickle juice in a shotcupmckenna and sophia phantom burping really loud. danny (theire daddy) love's this. and think's it's funny of themmommy and daddy use nondisciplinary action's on mckenna and sophiamutephantom burpphantom burpingpickle icee'sroll with laughterrolling with laughterrolls with laughtersensory bedroomsensory bedroom for mckenna and sophia fentonsensory friendly bedroomsnow cone
Load
sped 5 reading 641612
lillie
Friday
Apr 26, 2024
crydanny and samantha fenton giving tight-warm clinging hug's. and warm-gentle kisses to theire youngest kid's- twin daughter's: mckenna. and sophia. the twin's enjoy's this lovedanny and samantha fenton use nondisciplinary action's on mckenna and sophiadanny and samantha fenton-phantom finally turning theire disabled youngest kid's- five year old twin daughter's: mckenna and sophia into ghost. they explain the whole family is ghost. and they explain theire phantom development. the twin's are freaked out as they turn them into ghost. theire scared. and tyeire confused. mommy and daddy trie's calming them down. the twin's unknowingly and unintentionally fight mommy and daddy. and unknowingly and unintentionally refuse and resist transision. daddy no disciplinarian-restrain's them to calm down. but he just trie's soothing them with soft-kind gentle verbal warning. and soft-kind gentle loving hand's to chest as theire being lay'd on theire back's. he put's a soft-gentle hand to theire face to theire chin. and he talk's kindly-gently to them. and give's alot of warm-comforting love. and a soft-firm tender kind-tight gentle warm hug. and alot of soft-firm tender kind-tight gentle warm kisses to theire head and face. and he smile's at them to cheer and comfort themdanny and samantha fenton-phantom use nondisciplinary action's on mckenna and sophiadanny and samantha fenton-phantom use nondisciplinary action's on mckenna and sophiadanny and samantha fenton-phantom witnesses mckenna and sophia making scared-confused look's on theire cute little human face'sdanny and samantha fenton-phantom. ghost-human. or phantom fourm. feel uncomfortable punishing or disciplining mckenna or sophia. so they don't punish or discipline theire youngest babies. but instead. they just grab them gently by shoulder's. soft-gently kindly warn them "nono. that's wrong." clinge them tight for hug's and kisses. and mentor them. and guide them with right from wrong. and give afew soft quick-gentle tap's on sholder-neartheire neck. and a talk on right from wrong. and they tell them "yall aren't in trouble. i know yall don't know any better. or yall don't know right or wrong. but. were alway's here to help you. and toteach you." and they give eachother alot of tight warm hug's and sweet-warm kissesdanny and samantha fenton-phantom. ghost-human. or phantom fourm. feel uncomfortable punishing or disciplining mckenna or sophia. so they don't punish or discipline theire youngest babies. but instead. they just grab them gently by shoulder's. soft-gently kindly warn them "nono. that's wrong." clinge them tight for hug's and kisses. softly-gently tightly hold's them carefully with love's. and mentor them. and guide them with right from wrong. and give afew soft quick-gentle tap's on sholder-neartheire neck. and a talk on right from wrong. and they tell them "yall aren't in trouble. i know yall don't know any better. or yall don't know right or wrong. but. were alway's here to help you. and toteach you." and they give eachother alot of hug's and kissesdanny and samantha fenton-phantom. knowing theire youngest 5 year old babies. twin daughter's: mckenna. and sophia. with spd. don't like new thing's. they tell them "please try this." when comming to trying new thing's. suchas trying food'sdanny and samantha fenton-phantom. knowing theire youngest 5 year old babies. twin daughter's: mckenna. and sophia. with spd. don't like new thing's. they tell them "please try this." when comming to trying new thing's. suchas trying new food's. they don't forcefeeddanny and samantha fenton. knowing theire youngest 5 year old babies. twin daughter's: mckenna. and sophia. with spd. don't like new thing's. they tell them "please try this." when comming to trying new thing's. suchas trying new food's. they don't forcefeeddanny and samantha phantom use nondisciplinary action's on mckenna and sophiadanny and samantha phantom use nondisciplinary action's on mckenna and sophiadanny and samantha phantom. knowing theire youngest 5 year old babies. twin daughter's: mckenna. and sophia. with spd. don't like new thing's. they tell them "please try this." when comming to trying new thing's. suchas trying new food's. they don't forcefeeddanny fentondanny fenton-phantomdanny phantomloud burploud burpingmckenna and sophia fenton burping really loud. danny (theire daddy) love's this. and think's it's funny of themmckenna and sophia fenton was born with severe type1 classic galactosemia. no enzyme's to dygest anything milk or dairymckenna and sophia fenton-phantom burping really loud. danny (theire daddy) love's this. and think's it's funny of themmckenna and sophia phantom burping really loud. danny (theire daddy) love's this. and think's it's funny of themmckenna or sophia fenton not understanding anything mommy or daddy is trying to tell to them about the whole family being ghostmckenna or sophia fenton not understanding anything mommy or daddy is trying to tell to them about the whole family being ghost. theire really scaredmommy and daddy are nondisciplinarian's toward's mckenna and sophiamommy and daddy use nondisciplinary action's on mckenna and sophianappingno punishment on mckenna or fentonno punishment on mckenna or fenton-phantomno punishment on mckenna or phantomnondisciplinariannondisciplinarian for fenton twin'snondisciplinary actionnondisciplineprofound disabilitiessnow cone
Load
UFLI Review for Lesson 44
April Buchner
Friday
Apr 26, 2024
getgoeslocknotsayssicktrickyour
Load
School Related TERMS
Friday
Apr 26, 2024
assemblybathroombell schedulecafeteriaclassroomcollegecounselorelectivesexamsfield tripfriendsgrade point averagegraduationgymnasiumhealthroomhomeworklockerprincipalpromseniorssportstardyteacherwateryearbook
Load
m
Friday
Apr 26, 2024
acceptableadvisableamiableavailablebruiseconsiderablecurabledelectabledependabledesirablefulfilirritablelikeable lovablemalleablemistakable movablenoticeablesuitableunshakeablevariable
Load
Extra Spelling
C Moura
Friday
Apr 26, 2024
affectbatterycommunitydiscomfortdislikedistracting effectelectricityformula prismpyramidrecyclereplacingshapestreatment
Load
Unit 6 Week 1
Amber Henderson
Friday
Apr 26, 2024
dislikelabelprecookpresalerebuildreprintreturntinyunluckyunwrap
Load
Charlotte's Web List 3 and 4
Friday
Apr 26, 2024
beautifulboastexplosiongoosegroundgulliblehappyhystericsmiraclemorningoverpersuadepromisesedentarysheepsomethingterrificvaguelyverywondrous
Load
Spelling Packet 4/29 -5/3
Friday
Apr 26, 2024
AmazingAwesomeCrazierEarlierEasierFantasticFunnierHappierTerrificWonderful
Load
Q4 Spelling Week 2
Friday
Apr 26, 2024
architectbayonetdecipherman-of-warmerchantomenprowlingrebelsacrificeshantysuperstitiontatteredtempletraitorvessel
Load
Wonders Spelling Unit 6 Week 1
4th Grade
Friday
Apr 26, 2024
buttoncommoncottoncousindragonelevenmuffinoftenpenguinprovenraisinreasonriddenrobinshakenskeletonsunkenwagonwidenwoven
Load
Friday
Apr 26, 2024
actuallyawhilecomputerfeatureinformationinquirelocalopinionparagraphpicturepresentprintpublicationpublishpurposequiteregardreportsimilarsinglesolutionsolvestatementsubjectview
Load
Fundations Week 10 Lesson 2a
Tammy Rose
Friday
Apr 26, 2024
beneathbreadbrownieceilingchimneycookieeatfiercegeniemasterpieceoceanpailpalequeenremindsailsalesteakthirstyworld
Load
Words with -ly -ful
Oula Subei
Friday
Apr 26, 2024
helpfulhopefulkindlymouthfulpainfulquicklysadlysafelyslowlystrangelythankfulusefulusuallyweeklywishfulwonderful
Load
Friday
Apr 26, 2024
PleasePrettyRanRideSawSaySheSoonThatThereTheyThisTooUnderWantWasWellWentWhatWhiteWhoWillWith
Load
Friday
Apr 26, 2024
AreAtAteBrownButCameDidDoEatFourGetHaveHeIntoLikeMustNewNowOurOut
Load
Group 3 April/May sightwords
Denise Toles
Friday
Apr 26, 2024
BrotherCertainCompareFirsGrewIslandMyselfPartyPeoplePleaseSurfaceTowardWaterWerepleasure
Load
'Group 4 April/May sightwords
Denise Toles
Friday
Apr 26, 2024
CarryDuringExampleFigureGovermentLaterMachineNoticeNumeral PresentScienceShowSuddenlyThirdThrough
Load
Karie Feng
Friday
Apr 26, 2024
airalwaysbothdelightfulexamplegotgrouplifemightnextoftenpaperrunthose
Load
List 22- Words y changing to i plus a suffix
Friday
Apr 26, 2024
babiescarriedcitiescriesdeniedearlierflieshappinesshurriedkindnessloveliestmemoriespartiespenniesponiespuppiesrejoinsoftnessspiedstoriestriedunwrap
Load
List 29
Karen Lashley
Friday
Apr 26, 2024
disagreedisappeardisappointdishonestdislikemisbehavemisplacemisspellmisunderstandmisuserebuildrecallreviewrewriteunableunbeatenuncertainuncomfortableunkindunknown
Load
Module 9 Week 3
Friday
Apr 26, 2024
autographbiligybiographycalligraphyhomographhomophonemegaphonemicrophonemicroscopemicrowaveparagraphphotocopyphotographphotosynthesissaxophonesymphonytelegraphtelephontelescopeetelescopexylophone
Load
sped 5 reading 641591-1084691-t7zv
lillie
Friday
Apr 26, 2024
bubble'sclassic galactosemia eating disorder'scrycryingdanny and samantha fenton giving tight-warm clinging hug's. and warm-gentle kisses to theire youngest kid's- twin daughter's: mckenna. and sophia. the twin's enjoy's this lovedanny and samantha fenton giving tight-warm clinging hug's. and warm-gentle kisses to theire youngest kid's- twin daughter's: mckenna. and sophia. the twin's enjoy's this lovedanny and samantha fenton take's theire youngest kid's- twin daughter's: mckenna and sophia. to a metabolic doctor. to find out why theire not eating. doctor's test's theire enzyme's. classic galactosemia levle's. and enzyme levels. all very low in a 0. but they have high galactose level of 12.8 amount of galactose in theire bodie's. wich need's to get the galactose out of them. this scare's mommy and daddy to see galactose in them. but let's the doctor's do whatever they need to do for them to get it out of them. but mommy and daddy tell's doctor's "wait. before you do anything. we need to explain this to the twin's. or they'd really be scared." so they allow. they explain to the twin's. and hug tightly. and give several kisses to theire head. they start clinging mommy and daddy. but then trie's calming them down. doctor's also tell's parent's they don't have stomach. is why they don't eat. they encourage them to gently forcefeed them enough to gain weight. and they tell them theire dygestive level is 0. they really need to eat. this really scare's mommy and daddy. the twin's are in emergency surgery to get the toxic galactose poisoning toxin's out of themdanny and samantha fenton-phantom. ghost-human. or phantom fourm. feel uncomfortable punishing or disciplining mckenna or sophia. so they don't punish or discipline theire youngest babies. but instead. they just grab them gently by shoulder's. soft-gently kindly warn them "nono. that's wrong." clinge them tight for hug's and kisses. and mentor them. and guide them with right from wrong. and give afew soft quick-gentle tap's on sholder-neartheire neck. and a talk on right from wrong. and they tell them "yall aren't in trouble. i know yall don't know any better. or yall don't know right or wrong. but. were alway's here to help you. and toteach you." and they give eachother alot of hug's and kissesdanny and samantha fenton-phantom. ghost-human. or phantom fourm. feel uncomfortable punishing or disciplining mckenna or sophia. so they don't punish or discipline theire youngest babies. but instead. they just grab them gently by shoulder's. soft-gently kindly warn them "nono. that's wrong." clinge them tight for hug's and kisses. and mentor them. and guide them with right from wrong. and give afew soft quick-gentle tap's on sholder-neartheire neck. and a talk on right from wrong. and they tell them "yall aren't in trouble. i know yall don't know any better. or yall don't know right or wrong. but. were alway's here to help you. and toteach you." and they give eachother alot of hug's and kissesdanny and samantha fenton-phantom. knowing theire youngest 5 year old babies. twin daughter's: mckenna. and sophia. with spd. don't like new thing's. they tell them "please try this." when comming to trying new thing's. suchas trying food'sdanny and samantha fenton-phantom. knowing theire youngest 5 year old babies. twin daughter's: mckenna. and sophia. with spd. don't like new thing's. they tell them "please try this." when comming to trying new thing's. suchas trying food's. they don't forcefeeddanny and samantha fenton-phantom. knowing theire youngest 5 year old babies. twin daughter's: mckenna. and sophia. with spd. don't like new thing's. they tell them "please try this." when comming to trying new thing's. suchas trying new food's. they don't forcefeeddanny and samantha fenton. knowing theire youngest 5 year old babies. twin daughter's: mckenna. and sophia. with spd. don't like new thing's. they tell them "please try this." when comming to trying new thing's. suchas trying food's. they don't forcefeeddanny and samantha fenton. knowing theire youngest 5 year old babies. twin daughter's: mckenna. and sophia. with spd. don't like new thing's. they tell them "please try this." when comming to trying new thing's. suchas trying new food's. they don't forcefeeddanny and samantha phantom. knowing theire youngest 5 year old babies. twin daughter's: mckenna. and sophia. with spd. don't like new thing's. they tell them "please try this." when comming to trying new thing's. suchas trying food'sdanny and samantha phantom. knowing theire youngest 5 year old babies. twin daughter's: mckenna. and sophia. with spd. don't like new thing's. they tell them "please try this." when comming to trying new thing's. suchas trying food's. they don't forcefeeddanny and samantha phantom. knowing theire youngest 5 year old babies. twin daughter's: mckenna. and sophia. with spd. don't like new thing's. they tell them "please try this." when comming to trying new thing's. suchas trying new food's. they don't forcefeeddanny hold's onto his and samantha's five year old babies. mckenna and sophia. after they wake up in ghost transision. mckenna and sophia are so scared. they ask mommy and daddy "why doe's it have to hurt so much?" mommy and daddy look at eachother in shock with theire question. but then theire wondering the samethingeating disorder'sgalactosemia eating disorder'shesitant to speakmckenna and sophia fenton are awake from emergency surgery. but theire scared. and are hurting. doctor's explain's theire gonna' have traumatic scar's for life from theire surgery. mommy and daddy are sad for this. daddy look's at theire scar's on theire stomach. the twin's scream to mommy and daddy. "mommy! daddy! stomach burn's!" danny slowly-gently use's an icecore on theire bandaged stomach. the twin's make's a scared face in screaming fear "cold-cold." so daddy trie's to calm them down with a fireball to theire chest. he say's "calm down babie's." they clinge himmckenna and sophia fenton are screaming and crying. and in pain. stress. and fear. and are squirming. and theire unknowingly and unintentionally resisting mommy and daddy as they turn them into ghost. mommy or daddy don't allow this. but they don't punish or discipline them. they just try calming them down with soft gentle voice. verbal warning. and soft gentle touch to neck down to shoulder all the way down to lower-mid spine. and talk to them trying to calm them downmckenna and sophia fenton black's out in painfull panicing fear of becomming ghostmckenna and sophia fenton born mutemckenna and sophia fenton don't eat. this worrie's mommy and daddy. but danny (the twin's daddy). trie's them on a dairyfree classic galactosemia safe nutritional plant based vegan chocolate smoothie replacement shake-yogurt on-the-go drink. he hope's they like. wich they lovemckenna and sophia fenton first battle crymckenna and sophia fenton first ghosly wailmckenna and sophia fenton into painfull transisionmckenna and sophia fenton love's roasted marshmallow'smckenna and sophia fenton love's roasted marshmallow's. but aren't allowed to roast them unsupervised. so mommy or daddy doe's it for themmckenna and sophia fenton love's roasted marshmallow's. but aren't allowed to roast them unsupervised. so mommy or daddy doe's it for them. but let's them blow fire off theire marshmallowmckenna and sophia fenton stuttering disordermckenna and sophia fenton stuttering disorder keep's them mutemckenna and sophia fenton stuttering disorder keep's them shymckenna and sophia fenton voice therapy for nonverbal mute autism-mostly mute. including stutteringmckenna and sophia fenton was born with severe type1 classic galactosemia. no enzyme's to dygest anything milk or dairymckenna and sophia fenton- human form. burp's really loud. daddy in ghost form love's thismckenna and sophia fenton- human form. burp's really loud. daddy in human form love's thismckenna and sophia fenton-phantom love's kosher dill pickle'smckenna and sophia fenton-phantom was born with severe type1 classic galactosemia. no enzyme's to dygest anything milk or dairy. this is very sad new's to mommy and daddy to hear about theire infant twin babie'smckenna and sophia phantom was born with severe type1 classic galactosemia. no enzyme's to dygest anything milk or dairymckenna and sophia phantom- ghost form. burp's really loud. daddy in ghost form love's thisprofound disabilitiesverbal therapy for speech disorder's
Load
Friday
Apr 26, 2024
byintoride shethatwas
Load
Green Sort 36
Friday
Apr 26, 2024
Julyberrybodybrowniecandycherrycookiedenydizzydonkeyeeriegoaliejourneymoneymonkeymoviepinkiereplystoryturkeytwentyvalleyveryvolley
Load
List 29
Nicole Howard
Friday
Apr 26, 2024
blewbluebruisechewcoveredcruiseflewfruitgluegrouplistennewnewsscrewseveralsoupstatuestewsuitthrew
Load
Spelling Lesson 16
Joanne Wilbers
Friday
Apr 26, 2024
complaindifferentinstantinsteadoncequietquitquite
Load
Spelling 4 Language Arts Book Parts
Terri Breton
Friday
Apr 26, 2024
appendixcontentsdictionarydiscoverglossaryhelpfulindexlistsnonfictionreferencevolume
Load
sped 4/6 reading 641585-1084653-srnk
lillie
Friday
Apr 26, 2024
apple-cider vinegarette soak garlic-grilled green bean'sapple-cider vinegarette soak garlic-grilled green bean's n' cajun sauce marinated grilled garlic asparagusbalsamic vinegarette marinade style green-verde garlic style grilled asparagus and green bean'scajun style green bean'sclassic galactosemiaclassic galactosemia is a svere rare genetic-metabolic disorder babie's are born with. it's lifelong. and never goe's away. you never outgrow itcrydanny and samantha fenton giving tight-warm clinging hug's. and warm-gentle kisses to theire youngest kid's- twin daughter's: mckenna. and sophia. the twin's enjoy's this lovedanny and samantha fenton take's theire youngest kid's- twin daughter's: mckenna and sophia. to a metabolic doctor. to find out why theire not eating. doctor's test's theire enzyme's. classic galactosemia levle's. and enzyme levels. all very low in a 0. but they have high galactose level of 12.8 amount of galactose in theire bodie's. wich need's to get the galactose out of them. this scare's mommy and daddy to see galactose in them. but let's the doctor's do whatever they need to do for them to get it out of them. but mommy and daddy tell's doctor's "wait. before you do anything. we need to explain this to the twin's. or they'd really be scared." so they allow. they explain to the twin's. and hug tightly. and give several kisses to theire head. they start clinging mommy and daddy. but then trie's calming them down. doctor's also tell's parent's they don't have stomach. is why they don't eat. they encourage them to gently forcefeed them enough to gain weight. and they tell them theire dygestive level is 0. they really need to eat. this really scare's mommy and daddy. the twin's are in emergency surgery to get the toxic galactose poisoning toxin's out of themdanny and samantha fenton. knowing theire youngest 5 year old babies. twin daughter's: mckenna. and sophia. with spd. don't like new thing's. they tell them "please try this." when comming to trying new thing's. suchas trying food'sgalactosemiakosher dill pickle'smckenna and sophia fenton are awake from emergency surgery. but theire scared. and are hurting. doctor's explain's theire gonna' have traumatic scar's for life from theire surgery. mommy and daddy are sad for this. daddy look's at theire scar's on theire stomach. the twin's scream to mommy and daddy. "mommy! daddy! stomach burn's!" danny slowly-gently use's an icecore on theire bandaged stomach. the twin's make's a scared face in screaming fear "cold-cold." so daddy trie's to calm them down with a fireball to theire chest. he say's "calm down babie's." they clinge himmckenna and sophia fenton are mute-mostly mute. but they really love singing with mommy or daddymckenna and sophia fenton born mutemckenna and sophia fenton don't eat. this worrie's mommy and daddy. but danny (the twin's daddy). trie's them on a dairyfree classic galactosemia safe nutritional plant based vegan chocolate smoothie replacement shake-yogurt on-the-go drink. he hope's they like. wich they lovemckenna and sophia fenton love's kosher dill pickle'smckenna and sophia fenton stuttering disordermckenna and sophia fenton stuttering disorder keep's them mutemckenna and sophia fenton stuttering disorder keep's them shymckenna and sophia fenton voice therapy for nonverbal mute autism-mostly mute. including stutteringmckenna and sophia fenton was born with severe type1 classic galactosemia. no enzyme's to dygest anything milk or dairymckenna and sophia fenton was born with severe type1 classic galactosemia. no enzyme's to dygest anything milk or dairy. this is very sad new's to mommy and daddy to hear about theire infant twin'smckenna and sophia fenton-phantom love's kosher dill pickle'smckenna and sophia fenton-phantom was born with severe type1 classic galactosemia. no enzyme's to dygest anything milk or dairymckenna and sophia fenton-phantom was born with severe type1 classic galactosemia. no enzyme's to dygest anything milk or dairy. this is very sad new's to mommy and daddy to hear about theire infant twin babie'smckenna and sophia phantom love's kosher dill pickle'smckenna and sophia phantom was born with severe type1 classic galactosemia. no enzyme's to dygest anything milk or dairymckenna and sophia phantom was born with severe type1 classic galactosemia. no enzyme's to dygest anything milk or dairy. this is very sad new's to mommy and daddy to hear about theire infant twin babie'sno enzyme's to dygest milk or dairy
Load
ROOTS Vocab Lesson 18
Joanne Wilbers
Friday
Apr 26, 2024
interactiveinterfereintermittentintersectintervaltransacttransfertransfusiontransmittransparent
Load
sped 5/6 reading 641583-1084630-6bkp
lillie
Friday
Apr 26, 2024
autistic mute disorderclassic galactosemia eating disordercommunicate effectivelycommunicate effectively in a unique waycryeating disorder'seffectivelyfingerspellingfive year old fenton twin's mckenna and sophia can't hold silverware correctly. so mommy or daddy has to feed them. this sad moment really worrie's danny and samanthafive year old fenton-phantom twin's mckenna and sophia can't hold silverware correctly. so mommy or daddy has to feed them. this sad moment really worrie's danny and samanthafive year old phantom twin's mckenna and sophia can't hold silverware correctly. so mommy or daddy has to feed them. this sad moment really worrie's danny and samanthafive year old phantom-ghost human twin's. mckenna or sophia fenton or phantom may be mute's. but they do cry alotgalactosemia eating disorderghost human and phantom form girl's. twin sister's- mckenna or sophia fenton or phantom can't walk straight or sit or stand nor lay down straight. due to being born with severe scoliosisghost-human phantom twin's. mckenna or sophia fenton or phantom. unable to keep straight posture. due to being born with severe painfull scoliosisghost. human. or phantom form twin's- mckenna and sophia fenton. as ghost. human. or phantom fourm. can't eat hard food's. only soft meal's. suchas liquid's. grind up dishes. or mash potato or tater salad's for exzamplegrind up food- such as chicken saladliquid foodmash potatosmckenna and sophia fenton are mostly mute. but they communicate effectively in theire unique waymckenna and sophia fenton are mostly mute. rarely talkmckenna and sophia fenton are stutter's they go mutemckenna and sophia fenton were born mute-autistic. they rarely speakmckenna and sophia fenton were born mute. rarely speakmckenna and sophia fenton were born nonverbal mute-autistic. with epileptic absence seizure'smckenna and sophia fenton were born profoundly mutemckenna and sophia fenton were born profoundly mute. rarely speakmckenna and sophia fenton will alway's have fair-white skin due to being born 3- month's premie. as this causing neardeath health problem's sisnce birt. they died during birth. but danny fenton was forced by doctor's to goahead go ghost. and turn themmckenna and sophia fenton-phantom are mostly mute. but they communicate effectively in theire unique waymckenna and sophia fenton-phantom were born nonverbal mute-autisticmckenna and sophia fenton-phantom will alway's have fair-white skin due to being born 3- month's premie. as this causing neardeath health problem's sisnce birt. they died during birth. but danny fenton was forced by doctor's to goahead go ghost. and turn themmckenna and sophia phantom are mostly mute. but they communicate effectively in theire unique waymckenna and sophia phantom are mostly mute. mommy and daddy take's them to speach and voice therapy to learn to speakmckenna and sophia phantom are mostly mute. they rarely speakmckenna and sophia phantom are stutter's they go mutemckenna and sophia phantom will alway's have fair-white skin due to being born 3- month's premie. as this causing neardeath health problem's sisnce birt. they died during birth. but danny fenton was forced by doctor's to goahead go ghost. and turn themmommy and daddy teache's theire deaf-mute nonverbal autistic youngest kid's- twin daughter's: mckenna. and sophia fingerspelling. but the girl's don't understand it. theire having hard time trying to get this. daddy tell's them with interpretation "it's ok girl's. it's gonna' take time. were slowly learning this. well learn together. with eachother." this make's the twin's happy daddy said this to them. they hug tightly to him with tight clinging to him. danny just give's them several kisses to theire headmommy and daddy teache's theire deaf-mute nonverbal autistic youngest kid's- twin daughter's: mckenna. and sophia sign language. but the girl's don't understand it. theire having hard time trying to get this. daddy tell's them with interpretation "it's ok girl's. it's gonna' take time.for sign language. were slowly learning this. well learn together. with eachother. on asl or fingerspelling. including with sign language." this make's the twin's happy daddy said this to them. they hug tightly to him with tight clinging to him. danny kisses them several time's to theire headnonverbal-mute autisticperspectivephantom girl's- mckenna or sophia fenton or phantom. unable to keep straight posturepotato saladrarely ever speakrarely speaksign language
Load
Lesson 31 Test 5/3/24
Mindy Fox
Friday
Apr 26, 2024
acceptaccidentagentallergicannouncecelebratecenturychoicecyclonedangerdecidedigitemergencyexceptfragilegenerategeniusgiganticlegendmarginmessageprincerejoicesaucersuccess
Load
Spelling List 23
Mrs. R
Friday
Apr 26, 2024
August allalmostauthorclawdon'tdrawfaultlawnpausesalttallwasn'twe'veyawn
Load
Friday
Apr 26, 2024
ceilingchutecloseclothesheardherdhourmedalmeddleoursealingshootstraightstraittheirtheretootwo
Load